|
||||||
|
UniGene Name: uagpf_v2_unigene35674
Length: 221 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene35674
C |
|
Ace file of the UniGene uagpf_v2_unigene35674
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene6108 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pre-mRNA-processing-splicing factor [Arabidopsis thaliana] gb|AAD55467.1|AC009322_7 Putative splicing factor Prp8 [Arabidopsis thaliana] gb|AEE36353.1| Pre-mRNA-processing-splicing factor [Arabidopsis thaliana] | - | - | 0.0 | 92% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Blast2go | pre-mrna-processing-splicing factor 8-like | - | - | 0.0 | 96% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Sucrose synthase. | EC:2.4.1.13 | - | 0.0 | 96% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 96% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 96% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to hypoxia | GO:0001666 | Biological Process | 0.0 | 96% |
| Blast2go | sucrose biosynthetic process | GO:0005986 | Biological Process | 0.0 | 96% |
| Blast2go | starch metabolic process | GO:0005982 | Biological Process | 0.0 | 96% |
| Blast2go | seed maturation | GO:0010431 | Biological Process | 0.0 | 96% |
| Blast2go | nuclear mRNA splicing, via spliceosome | GO:0000398 | Biological Process | 0.0 | 96% |
| Blast2go | sucrose synthase activity | GO:0016157 | Molecular Function | 0.0 | 96% |
| Blast2go | cytosol | GO:0005829 | Cellular Component | 0.0 | 96% |
| Blast2go | spliceosomal complex | GO:0005681 | Cellular Component | 0.0 | 96% |
| Blast2go | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | 96% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 96% |
| Blast2go | chloroplast | GO:0009507 | Cellular Component | 0.0 | 96% |
| Blast2go | membrane | GO:0016020 | Cellular Component | 0.0 | 96% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | JAB1/Mov34/MPN/PAD-1 | IPR000555 | - | 0.0 | - |
| Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
| Sma3 | FAS1 domain | IPR000782 | - | 0.0 | - |
| Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation/beta-lactamase-inhibitor protein II | IPR009091 | - | 0.0 | - |
| Sma3 | Pre-mRNA-processing-splicing factor 8 | IPR012591 | - | 0.0 | - |
| Sma3 | PROCN | IPR012592 | - | 0.0 | - |
| Sma3 | PRO, C-terminal | IPR012984 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | EGF, extracellular | IPR013111 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ABN8
Fln msg: Overlapping hits, possible frame ERROR between 185 and 173, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 155 aas, your sequence is shorter than subject: 73 - 422
Fln protein:
S
Protein Length:
74
Fln nts:
C
Fln Alignment:
uagpf_mira_c23321___ICIADLRTQISGYIYGISPPDNPQVKEIRCIAMPPQWGTHQQVHLPLALPxxxxLNDLEPLGWMHT
D5ABN8________________ICIADLRTQISGYIYGISPPDNPQVKEIRCIAMPPQWGTHQQVHLPLALPxxxxLNDLEPLGWMHT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
