UniGene Name: uagpf_v2_unigene35396
Length: 181 nt
UniGene Fasta |
---|
>uagpf_v2_unigene35396
A |
Ace file of the UniGene uagpf_v2_unigene35396 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene2844 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | UDP-glucosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9SCH3_RICCO | - | - | 0.0 | 40% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Blast2go | udp-glycosyltransferase 86a1 | - | - | 0.0 | 65% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 0.0 | 65% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 65% |
Blast2go | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | 65% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPT9
Fln msg: Distance to subject end: 159 aas, your sequence is shorter than subject: 60 - 487
Fln protein:
R
Protein Length:
61
Fln nts:
A
Fln Alignment:
uagpf_mira_c22979___VGTSIWTECDCSKWLDAKSNRSVLYVSFGSMVFVTKAQLEEIAMGLKDSGQLFLWALRP
C0PPT9________________VGTSIWTQYDASEWLDAKPNGSVIYVSFGSLIHATKAQLEEIAMGLKDSGQFFLWVLRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain