UniGene Name: uagpf_v2_unigene35354
Length: 173 nt
![]() |
---|
>uagpf_v2_unigene35354
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene184 | 1/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Mitogen activated protein kinase kinase kinase-like protein [Arabidopsis thaliana] ref|NP_850718.1| Mitogen activated protein kinase kinase kinase-like protein [Arabidopsis thaliana] gb|AAK83572.1| AT3g58640/F14P22_230 [Arabidopsis thaliana] gb|AAM98106.1 | - | - | 0.0 | 50% |
FL-Next | tr=Predicted protein; subsp. trichocarpa). | - | - | 0.0 | 72% |
Blast2go | mitogen activated protein kinase kinase kinase-like protein | - | - | 0.0 | 74% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 74% |
Blast2go | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | 74% |
Blast2go | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | 74% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: B9GTC5
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 57 - 352
Fln protein:
S
Protein Length:
58
Fln nts:
C
Fln Alignment:
uagpf_mira_c22925___SVAHEGARLEIPEGPIGKLISDCWAYADDRPSYEEIFARLHDCE
B9GTC5________________AVANERSRLEIPEGPLGKLISDCWADSHLRPSCEEILSRLHDCE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain