UniGene Name: uagpf_v2_unigene35226
Length: 216 nt
UniGene Fasta |
---|
>uagpf_v2_unigene35226
C |
Ace file of the UniGene uagpf_v2_unigene35226 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene2873 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase, putative n=1 Tax=Ricinus communis RepID=B9S040_RICCO | - | - | 0.0 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Blast2go | protein | - | - | 0.0 | 78% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-tyrosine kinases. | EC:2.7.10.- | - | 0.0 | 78% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 78% |
Blast2go | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | 78% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 78% |
Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A860
Fln msg: Distance to subject end: 405 aas, your sequence is shorter than subject: 71 - 550
Fln protein:
V
Protein Length:
72
Fln nts:
C
Fln Alignment:
uagpf_mira_c22773___VVTLAVTQVFCRNISNGCWVGGRGVNSQKGFSWEWSDHRTLWNNSVFPGAXXXXXXXXXXXXXXXXXDFCT
D5A860________________VQELKYVQAFCRNISNGCWVGGRGVNSQKGFSWEWSDHRTLWNNSVFPGAPSPLNCSNSSCLNTNLTDFCT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain