UniGene Name: uagpf_v2_unigene34718
Length: 197 nt
UniGene Fasta |
---|
>uagpf_v2_unigene34718
C |
Ace file of the UniGene uagpf_v2_unigene34718 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene5239 | 1/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Multidrug resistance pump, putative n=1 Tax=Ricinus communis RepID=B9RIU7_RICCO | - | - | 0.0 | 59% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
Blast2go | detoxifying efflux carrier 35 | - | - | 0.0 | 77% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | pollen development | GO:0009555 | Biological Process | 0.0 | 77% |
Blast2go | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | 77% |
Blast2go | flavonoid metabolic process | GO:0009812 | Biological Process | 0.0 | 77% |
Blast2go | anther dehiscence | GO:0009901 | Biological Process | 0.0 | 77% |
Blast2go | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | 77% |
Blast2go | antiporter activity | GO:0015297 | Molecular Function | 0.0 | 77% |
Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKL5
Fln msg: STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 65 - 500
Fln protein:
V
Protein Length:
66
Fln nts:
C
Fln Alignment:
uagpf_mira_c22163___HYLFGVPLGCLLGCYFDLGVEGIWAGMITGTVVQTLVLCIVTYKTKWNKEASQAKDRI
B8LKL5________________YYLFGVPLGCLLGYYFDLGVEGIWAGMISGTLLQTIILCIITYRTKWNKEANQAKARI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain