|
||||||
|
UniGene Name: uagpf_v2_unigene34085
Length: 169 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene34085
C |
|
Ace file of the UniGene uagpf_v2_unigene34085
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1149 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 n=1 Tax=Populus trichocarpa RepID=MTBC_POPTR | - | - | 0.0 | 70% |
| FL-Next | sp=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1; subsp. trichocarpa). | - | - | 0.0 | 89% |
| Blast2go | probable bifunctional methylthioribulose-1-phosphate dehydratase enolase-phosphatase e1-like | - | - | 0.0 | 81% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Methylthioribulose 1-phosphate dehydratase. | EC:4.2.1.109 | - | 0.0 | 81% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 81% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 81% | |
| Blast2go | Phosphoglycolate phosphatase. | EC:3.1.3.18 | - | 0.0 | 81% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glyoxylate and dicarboxylate metabolism | 00630 | 0.0 | 81% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 81% | |
| Blast2go | Acireductone synthase. | EC:3.1.3.77 | - | 0.0 | 81% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 81% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 81% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | 81% |
| Blast2go | methylthioribulose 1-phosphate dehydratase activity | GO:0046570 | Molecular Function | 0.0 | 81% |
| Blast2go | phosphoglycolate phosphatase activity | GO:0008967 | Molecular Function | 0.0 | 81% |
| Blast2go | metal ion binding | GO:0046872 | Molecular Function | 0.0 | 81% |
| Blast2go | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | 81% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 81% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Class II aldolase/adducin N-terminal | IPR001303 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 1 | IPR006439 | - | 0.0 | - |
| Sma3 | 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | IPR010041 | - | 0.0 | - |
| Sma3 | Methylthioribulose-1-phosphate dehydratase | IPR017714 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: B9N1F9
Fln msg: Distance to subject end: 355 aas, your sequence is shorter than subject: 56 - 504
Fln protein:
R
Protein Length:
57
Fln nts:
C
Fln Alignment:
uagpf_mira_c21386___CSDCGPLFLKAYQMRNAGAVIHSHGLESCLATMIHPLSKEFRITHMEM
B9N1F9________________CSDCAPLFLKAYDMRNAGAVIHSHGMESCLVTMINPLSKEFRITHMEM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
