|
||||||
|
UniGene Name: uagpf_v2_unigene33197
Length: 213 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene33197
G |
|
Ace file of the UniGene uagpf_v2_unigene33197
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene2009 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-n-acteylglucosamine pyrophosphorylase, putative n=1 Tax=Ricinus communis RepID=B9S2T0_RICCO | - | - | 0.0 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Blast2go | udp-sugar pyrophosphorylase | - | - | 0.0 | 84% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | UTP--xylose-1-phosphate uridylyltransferase. | EC:2.7.7.11 | - | 0.0 | 84% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 84% | |
| Blast2go | EC:2.7.7.1- | - | 0.0 | 84% | |
| Blast2go | Glucuronate-1-phosphate uridylyltransferase. | EC:2.7.7.44 | - | 0.0 | 84% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Pentose and glucuronate interconversions | 00040 | 0.0 | 84% | |
| Blast2go | Ascorbate and aldarate metabolism | 00053 | 0.0 | 84% | |
| Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 84% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 84% | |
| Blast2go | UTP--glucose-1-phosphate uridylyltransferase. | EC:2.7.7.9 | - | 0.0 | 84% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Pentose and glucuronate interconversions | 00040 | 0.0 | 84% | |
| Blast2go | Galactose metabolism | 00052 | 0.0 | 84% | |
| Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 84% | |
| Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 84% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 84% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 84% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | pollen development | GO:0009555 | Biological Process | 0.0 | 84% |
| Blast2go | UDP-glucuronate metabolic process | GO:0046398 | Biological Process | 0.0 | 84% |
| Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 84% |
| Blast2go | UDP-L-arabinose metabolic process | GO:0033356 | Biological Process | 0.0 | 84% |
| Blast2go | UDP-glucose metabolic process | GO:0006011 | Biological Process | 0.0 | 84% |
| Blast2go | UTP:arabinose-1-phosphate uridylyltransferase activity | GO:0010491 | Molecular Function | 0.0 | 84% |
| Blast2go | UTP:xylose-1-phosphate uridylyltransferase activity | GO:0047338 | Molecular Function | 0.0 | 84% |
| Blast2go | UTP:galactose-1-phosphate uridylyltransferase activity | GO:0017103 | Molecular Function | 0.0 | 84% |
| Blast2go | glucuronate-1-phosphate uridylyltransferase activity | GO:0047350 | Molecular Function | 0.0 | 84% |
| Blast2go | UTP:glucose-1-phosphate uridylyltransferase activity | GO:0003983 | Molecular Function | 0.0 | 84% |
| Blast2go | UDP-D-galactose metabolic process | GO:0052573 | Biological Process | 0.0 | 84% |
| Blast2go | pollen tube | GO:0090406 | Biological Process | 0.0 | 84% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UTP--glucose-1-phosphate uridylyltransferase | IPR002618 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P174
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 71 - 204
Fln protein:
D
Protein Length:
72
Fln nts:
G
Fln Alignment:
uagpf_mira_c20323___DQVEKLDTSYPGGLRSYIHNARQLLADSKAGKNPFSGFSPSVPAGEVLSFGDENFIKFEEAGIREACDAAF
A9P174________________DQVEKLDASYPGGLRSYIHNARQLLTDSKAGKNPFDGFTPSVPAGEVLSFGDENFIKFEEAGIKEACDAAF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
