UniGene Name: uagpf_v2_unigene32835
Length: 197 nt
UniGene Fasta |
---|
>uagpf_v2_unigene32835
C |
Ace file of the UniGene uagpf_v2_unigene32835 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene3209 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Hexokinase 6 n=1 Tax=Nicotiana tabacum RepID=Q6Q8A0_TOBAC | - | - | 0.0 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
Blast2go | hexokinase | - | - | 0.0 | 77% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Glucokinase. | EC:2.7.1.2 | - | 0.0 | 77% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Glycolysis / Gluconeogenesis | 00010 | 0.0 | 77% | |
Blast2go | Galactose metabolism | 00052 | 0.0 | 77% | |
Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 77% | |
Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 77% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 77% | |
Blast2go | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | 77% | |
Blast2go | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | 77% | |
Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 77% | |
Blast2go | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | 77% | |
Blast2go | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | 77% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 77% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 77% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 77% | |
Blast2go | Fructokinase. | EC:2.7.1.4 | - | 0.0 | 77% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Fructose and mannose metabolism | 00051 | 0.0 | 77% | |
Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 77% | |
Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 77% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 77% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | 77% |
Blast2go | response to cold | GO:0009409 | Biological Process | 0.0 | 77% |
Blast2go | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | 77% |
Blast2go | response to salt stress | GO:0009651 | Biological Process | 0.0 | 77% |
Blast2go | glucokinase activity | GO:0004340 | Molecular Function | 0.0 | 77% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 77% |
Blast2go | fructokinase activity | GO:0008865 | Molecular Function | 0.0 | 77% |
Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 77% |
Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 77% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transcription factor TFIIB | IPR000812 | - | 0.0 | - |
Sma3 | IPR001092 | - | 0.0 | - | |
Sma3 | Hexokinase | IPR001312 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRJ7
Fln msg: Distance to subject end: 428 aas, your sequence is shorter than subject: 65 - 551
Fln protein:
A
Protein Length:
66
Fln nts:
C
Fln Alignment:
uagpf_mira_c19900___KWNRVVGILRDFEEGCSTPLYRLRQLVDAMAVEMHAG
B8LRJ7________________EWKRAEGIVKELERQCSTPISRLREVVDAMAEELRVG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain