UniGene Name: uagpf_v2_unigene32834
Length: 203 nt
![]() |
---|
>uagpf_v2_unigene32834
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene4284 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative methyltransferase PMT6 [Arabidopsis thaliana] sp|Q84TJ0.1|PMT6_ARATH RecName: Full=Probable methyltransferase PMT6 gb|AAO64151.1| unknown protein [Arabidopsis thaliana] dbj|BAF00512.1| hypothetical protein [Arabidopsis thaliana] gb|AEE74871.1| pu | - | - | 0.0 | 55% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Blast2go | probable methyltransferase pmt7-like | - | - | 0.0 | 75% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 75% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 75% |
Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 75% |
Blast2go | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | 75% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Putative S-adenosyl-L-methionine-dependent methyltransferase | IPR004159 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Cytokine-induced anti-apoptosis inhibitor 1 | IPR007785 | - | 0.0 | - |
Sma3 | IPR017909 | - | 0.0 | - | |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKR7
Fln msg: Distance to subject end: 423 aas, your sequence is shorter than subject: 67 - 592
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
uagpf_mira_c19899___RRENFERNCPPLEELPFCLXXXXXXXXXXXXXXXSKDYVWRSNVNHSHLAEVKGGQNWVHERGKLWW
B8LKR7________________RRENFERNCPPLEERPFCLIPPPKEYKIPIKWPISKDYVWRSNVNHSHLAEVKGGQNWVHEQGKLWW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain