|
||||||
|
UniGene Name: uagpf_v2_unigene31045
Length: 225 nt
 UniGene Fasta
|
|---|
| >uagpf_v2_unigene31045
C |
|
Ace file of the UniGene uagpf_v2_unigene31045
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene14414 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pyridoxal phosphate dependent transferase-like protein [Arabidopsis thaliana] gb|AAG52437.1|AC018848_8 putative aspartate aminotransferase; 38163-36256 [Arabidopsis thaliana] gb|AAM13158.1| putative aspartate aminotransferase [Arabidopsis thaliana] gb|AAP | - | - | 0.0 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 82% |
| Blast2go | transaminase transferring nitrogenous groups | - | - | 0.0 | 82% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Aspartate transaminase. | EC:2.6.1.1 | - | 0.0 | 82% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 82% | |
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 82% | |
| Blast2go | Arginine and proline metabolism | 00330 | 0.0 | 82% | |
| Blast2go | Tyrosine metabolism | 00350 | 0.0 | 82% | |
| Blast2go | Phenylalanine metabolism | 00360 | 0.0 | 82% | |
| Blast2go | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 0.0 | 82% | |
| Blast2go | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | 82% | |
| Blast2go | Isoquinoline alkaloid biosynthesis | 00950 | 0.0 | 82% | |
| Blast2go | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 0.0 | 82% | |
| Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 82% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 82% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 82% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 82% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 82% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | biosynthetic process | GO:0009058 | Biological Process | 0.0 | 82% |
| Blast2go | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | 82% |
| Blast2go | L-aspartate:2-oxoglutarate aminotransferase activity | GO:0004069 | Molecular Function | 0.0 | 82% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1-aminocyclopropane-1-carboxylate synthase | IPR001176 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7U0Q3
Fln msg: Distance to subject end: 105 aas, your sequence is shorter than subject: 74 - 394
Fln protein:
V
Protein Length:
75
Fln nts:
C
Fln Alignment:
uagpf_mira_c13943___VINVFSFSKAYGMMGWRVGYIAYPSEVEGLAAQLLKTQDNIPICASIIGQKLALYSLELGAEWV
D7U0Q3________________IVNIFSFSKAYGMMGWRVGYIAYPSNVEGLGAQLLKVQDNIPICASIFSQHLALYSLEMGPEWV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
