UniGene Name: uagpf_v2_unigene30401
Length: 187 nt
![]() |
---|
>uagpf_v2_unigene30401
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene4324 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Multidrug resistance-associated protein 2, 6 (Mrp2, 6), abc-transoprter, putative n=1 Tax=Ricinus communis RepID=B9SAP4_RICCO | - | - | 0.0 | 53% |
FL-Next | sp=ABC transporter C family member 4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 61% |
Blast2go | multidrug resistance protein abc transporter family | - | - | 0.0 | 76% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | stomatal movement | GO:0010118 | Biological Process | 0.0 | 76% |
Blast2go | response to water deprivation | GO:0009414 | Biological Process | 0.0 | 76% |
Blast2go | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | 76% |
Blast2go | response to wounding | GO:0009611 | Biological Process | 0.0 | 76% |
Blast2go | folic acid transport | GO:0015884 | Biological Process | 0.0 | 76% |
Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 76% |
Blast2go | response to nematode | GO:0009624 | Biological Process | 0.0 | 76% |
Blast2go | folic acid transporter activity | GO:0008517 | Molecular Function | 0.0 | 76% |
Blast2go | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | 76% |
Blast2go | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | 76% |
Blast2go | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | 76% |
Blast2go | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | 76% |
Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 76% |
Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | 76% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 76% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7DM58
Fln msg: Distance to subject end: 435 aas, your sequence is shorter than subject: 62 - 1516
Fln protein:
S
Protein Length:
63
Fln nts:
T
Fln Alignment:
uagpf_mira_c12564___GLRTAQEFYQTMLDSIFRAPMSFFDTIPTGRILTRSSTDQQKLDFDIPFIYG
Q7DM58________________GLKTAQIFFRQILNSILHAPMSFFDTTPSGRILSRASTDQTNVDILIPFMLG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain