UniGene Name: uagpf_v2_unigene28942
Length: 234 nt
UniGene Fasta |
---|
>uagpf_v2_unigene28942
A |
Ace file of the UniGene uagpf_v2_unigene28942 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene1956 | 1/2 |
SustainPine v2.0 | sp_v2.0_unigene78250 | 1/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Multidrug/pheromone exporter protein n=1 Tax=Hevea brasiliensis RepID=F2YGT1_HEVBR | - | - | 0.0 | 62% |
FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 67% |
Blast2go | abc transporter b family member | - | - | 0.0 | 79% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 0.0 | 79% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | transmembrane transport | GO:0055085 | Biological Process | 0.0 | 79% |
Blast2go | ATP catabolic process | GO:0006200 | Biological Process | 0.0 | 79% |
Blast2go | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | 79% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 79% |
Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 79% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 79% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Ribosomal protein L10, eubacterial, conserved site | IPR002363 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
Sma3 | Vacuolar fusion protein MON1 | IPR004353 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Sma3 | Leucine-rich repeat 2 | IPR013101 | - | 0.0 | - |
Sma3 | IPR013596 | - | 0.0 | - | |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Distance to subject end: 16 aas, your sequence is shorter than subject: 77 - 1316
Fln protein:
A
Protein Length:
78
Fln nts:
A
Fln Alignment:
uagpf_mira_c9454___AIARAIIKNPSILLLDEATSALDSHSEKVVQEALDGVMVGRTSVVVAHRLSTIQNADSIAVIENGKVVEQGNHASLL
E6Y0T0________________AIARAILKDPRILLLDEATSALDTESERVVQEALDRIMVNRTTVIVAHRLTTVRNADMIAVVQRGSIVEKGSHSQLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain