SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene28808

Length: 433 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>uagpf_v2_unigene28808
CGTCGTGACCTTGGCTGTCACTCAGCTTTCCAAACTCATGAAGGCCATTATGAGTCCTTGGTCATGCCATTCGGTCTTTGTAATGCCCCATCTACTTTTAAGAGCCTTATGAACCACCTTCTCAAACCATATCTCAGGAAATTTGTCCTTGTCTTCTTCGATGACATCCTCATCTATAGTTGCACTTGGGCCGCACATCTTCAGCATGTAGATCTACTCTTGCAACTGCTCCGCAAGCATAAATTATTTGTTAAGATGTCCAAGTGTTCATTTGGCATGGAAGAAGTTGAGTATTTGGGCCACATTGTGGGGCGTGAAGGTGTCAAGGTGGACCCCAAAAAGATCCAGGCAATGCAAGAATGGCCTCAACCTAAGACCTTGAAGAGCTTGAGAGGATTTTTGGGTCTCACAGGCTACTAACGCAAATTTGTCC

Ace file of the UniGene uagpf_v2_unigene28808 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene35179	4/5

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RVT_1 domain containing protein	-	-	3.0e-31	26%
FL-Next	sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion.	-	-	0.0	53%
Blast2go	ac051624_3 retroelement	-	-	0.0	80%

Source	GOs	Term	Type	Identity
Blast2go	cellular process	GO:0009987	Biological Process	80%
Blast2go	primary metabolic process	GO:0044238	Biological Process	80%
Blast2go	macromolecule metabolic process	GO:0043170	Biological Process	80%
Blast2go	binding	GO:0005488	Molecular Function	80%

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Carbonic anhydrase	IPR001765	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Protein translocase complex, SecE/Sec61-gamma subunit	IPR001901	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Carbohydrate/puine kinase, PfkB, conserved site	IPR002173	-	-
Sma3	Lipase, class 3	IPR002921	-	-
Sma3	Intron-encoded nuclease 2	IPR003611	-	-
Sma3	Peptidase C48, SUMO/Sentrin/Ubl1	IPR003653	-	-
Sma3	Exostosin-like	IPR004263	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Carbamoyl-phosphate synthetase, large subunit, ATP-binding	IPR005479	-	-
Sma3	General substrate transporter	IPR005828	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	FBD	IPR006566	-	-
Sma3	Protein of unknown function DUF594	IPR007658	-	-
Sma3	Domain of unknown function DUF834	IPR008552	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	Carbonic anhydrase, prokaryotic-like, conserved site	IPR015892	-	-
Sma3	MULE transposase domain	IPR018289	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: sp_plants

Fln subject: P92523

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 78 aas, your sequence is shorter than subject: 119 - 158

Fln protein: MPFGLCNAPSTFKSLMNHLLKPYLRKFVLVFFDDILIYSCTWAAHLQHVDLLLQLLRKHKLFVKMSKCSFGMEEVEYLGHIVGREGVKVDPKKIQAMQEWPQPKTLKSLRGFLGLTGY*

Protein Length: 120

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGCTTTCCAAACTCATGAAGGCCATTATGAGTCCTTGGTC_-_ATGCCATTCGGTCTTTGTAATGCCCCATCTACTTTTAAGAGCCTTATGAACCACCTTCTCAAACCATATCTCAGGAAATTTGTCCTTGTCTTCTTCGATGACATCCTCATCTATAGTTGCACTTGGGCCGCACATCTTCAGCATGTAGATCTACTCTTGCAACTGCTCCGCAAGCATAAATTATTTGTTAAGATGTCCAAGTGTTCATTTGGCATGGAAGAAGTTGAGTATTTGGGCCACATTGTGGGGCGTGAAGGTGTCAAGGTGGACCCCAAAAAGATCCAGGCAATGCAAGAATGGCCTCAACCTAAGACCTTGAAGAGCTTGAGAGGATTTTTGGGTCTCACAGGCTACTAACGCAAATTTGTCC

Fln Alignment:

uagpf_mira_c9127___FVKMSKCSFGMEEVEYLGH--IVGREGVKVDPKKIQAMQEWPQPKTLKSLRGFLGLTGY*RKFV
P92523________________YANRKKCAFGQPQIAYLGHRHIISGEGVSADPAKLEAMVGWPEPKNTTELRGFLGLTGYYRRFV

SNPs (tot: 17)

Position	A %	C %	G %	T %	Probability
164	20	40		40	1.0
179	20	80			0.995493
182	50		50		1.0
201	20	80			0.995493
202	20		80		0.995493
203	20		80		0.995493
204	80			20	0.995493
212	20		80		0.995493
219		33		66	0.997452
233	33		66		0.997452
242		66		33	0.997452
243	50		50		1.0
254	75	25			0.996473
258	66		33		0.997452
282	25		75		0.996479
290	25	75			0.996474
317			75	25	0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain