UniGene Name: uagpf_v2_unigene28776
Length: 228 nt
UniGene Fasta
|
|---|
| >uagpf_v2_unigene28776
C |
Ace file of the UniGene uagpf_v2_unigene28776
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1881 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Histone deacetylase (Fragment) n=2 Tax=Malpighiales RepID=B9IEX4_POPTR | - | - | 0.0 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Blast2go | histone deacetylase | - | - | 0.0 | 87% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Histone deacetylase. | EC:3.5.1.98 | - | 0.0 | 87% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | jasmonic acid and ethylene-dependent systemic resistance | GO:0009861 | Biological Process | 0.0 | 87% |
| Blast2go | seed maturation | GO:0010431 | Biological Process | 0.0 | 87% |
| Blast2go | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | 87% |
| Blast2go | histone deacetylation | GO:0016575 | Biological Process | 0.0 | 87% |
| Blast2go | response to salt stress | GO:0009651 | Biological Process | 0.0 | 87% |
| Blast2go | negative regulation of transcription, DNA-dependent | GO:0045892 | Biological Process | 0.0 | 87% |
| Blast2go | DNA mediated transformation | GO:0009294 | Biological Process | 0.0 | 87% |
| Blast2go | posttranscriptional gene silencing | GO:0016441 | Biological Process | 0.0 | 87% |
| Blast2go | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | 87% |
| Blast2go | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | 87% |
| Blast2go | histone acetylation | GO:0016573 | Biological Process | 0.0 | 87% |
| Blast2go | NAD-dependent histone deacetylase activity (H3-K9 specific) | GO:0046969 | Molecular Function | 0.0 | 87% |
| Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 87% |
| Blast2go | NAD-dependent histone deacetylase activity (H3-K14 specific) | GO:0032041 | Molecular Function | 0.0 | 87% |
| Blast2go | NAD-dependent histone deacetylase activity (H4-K16 specific) | GO:0046970 | Molecular Function | 0.0 | 87% |
| Blast2go | histone deacetylase activity (H4-K16 specific) | GO:0034739 | Molecular Function | 0.0 | 87% |
| Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | 87% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 87% |
| Blast2go | regulation of multicellular organismal development | GO:2000026 | Biological Process | 0.0 | 87% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone deacetylase superfamily | IPR000286 | - | 0.0 | - |
| Sma3 | Histone deacetylase | IPR003084 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: B8LP03
Fln msg: query STOP codon is far from subject stop. Distance to subject end: 22 aas, atg_distance in limit (1-15): atg_distance = 15, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 45 - 102
Fln protein:
M
Protein Length:
46
Fln nts:
C
Fln Alignment:
uagpf_mira_c9072___KRSKCRIWDGEYVGSESEEDGKPPIFDADTYERSVLKHENK
B8LP03________________KRSKCRIWDGEYFGSESEEDGKPPRCDADTYVRSVLKHENK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta