UniGene Name: uagpf_v2_unigene28635
Length: 234 nt
UniGene Fasta |
---|
>uagpf_v2_unigene28635
G |
Ace file of the UniGene uagpf_v2_unigene28635 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene6299 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | arabinose kinase [Arabidopsis thaliana] sp|O23461.1|ARAK_ARATH RecName: Full=L-arabinokinase; Short=AtISA1 emb|CAB10392.1| galactokinase like protein [Arabidopsis thaliana] emb|CAB78655.1| galactokinase like protein [Arabidopsis thaliana] gb|AEE83696.1| a | - | - | 0.0 | 67% |
FL-Next | sp=L-arabinokinase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 83% |
Blast2go | galactokinase like protein | - | - | 0.0 | 83% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | L-arabinokinase. | EC:2.7.1.46 | - | 0.0 | 83% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 83% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 83% | |
Blast2go | Galactokinase. | EC:2.7.1.6 | - | 0.0 | 83% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Galactose metabolism | 00052 | 0.0 | 83% | |
Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 83% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 83% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | arabinose metabolic process | GO:0019566 | Biological Process | 0.0 | 83% |
Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 83% |
Blast2go | RNA processing | GO:0006396 | Biological Process | 0.0 | 83% |
Blast2go | L-arabinokinase activity | GO:0009702 | Molecular Function | 0.0 | 83% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 83% |
Blast2go | galactokinase activity | GO:0004335 | Molecular Function | 0.0 | 83% |
Blast2go | cytoplasm | GO:0005737 | Cellular Component | 0.0 | 83% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Galactokinase | IPR000705 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 10 | IPR001000 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | GHMP kinase, ATP-binding, conserved site | IPR006203 | - | 0.0 | - |
Sma3 | GHMP kinase N-terminal domain | IPR006204 | - | 0.0 | - |
Sma3 | Mevalonate/galactokinase | IPR006206 | - | 0.0 | - |
Sma3 | IPR012366 | - | 0.0 | - | |
Sma3 | Galactokinase, glycosyltransferase | IPR012369 | - | 0.0 | - |
Sma3 | GHMP kinase, C-terminal domain | IPR013750 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O23461
Fln msg: Distance to subject end: 433 aas, your sequence is shorter than subject: 78 - 1039
Fln protein:
A
Protein Length:
79
Fln nts:
G
Fln Alignment:
uagpf_mira_c8762___LFNWEDVLFVARAPGRLDVMGGIADYSGSLVLQMPIKEACHVAVQRSHPSKQRLWKHALARQHAR
O23461________________LFNWEEEIFVARAPGRLDVMGGIADYSGSLVLQMPIREACHVAVQRNLPGKHRLWKHAQARQQAK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain