UniGene Name: uagpf_v2_unigene28532
Length: 192 nt
UniGene Fasta |
---|
>uagpf_v2_unigene28532
G |
Ace file of the UniGene uagpf_v2_unigene28532 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene14035 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | lipoamide dehydrogenase 1 [Arabidopsis thaliana] gb|AEE75888.1| lipoamide dehydrogenase 1 [Arabidopsis thaliana] | - | - | 0.0 | 76% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Blast2go | dihydrolipoyl dehydrogenase-like | - | - | 0.0 | 89% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Dihydrolipoyl dehydrogenase. | EC:1.8.1.4 | - | 0.0 | 89% |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Glycolysis / Gluconeogenesis | 00010 | 0.0 | 89% | |
Blast2go | Citrate cycle (TCA cycle) | 00020 | 0.0 | 89% | |
Blast2go | Glycine, serine and threonine metabolism | 00260 | 0.0 | 89% | |
Blast2go | Valine, leucine and isoleucine degradation | 00280 | 0.0 | 89% | |
Blast2go | Pyruvate metabolism | 00620 | 0.0 | 89% | |
Blast2go | Biosynthesis of phenylpropanoids | 01061 | 0.0 | 89% | |
Blast2go | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | 89% | |
Blast2go | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | 89% | |
Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 89% | |
Blast2go | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | 89% | |
Blast2go | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | 89% | |
Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 89% | |
Blast2go | Metabolic pathways | 01100 | 0.0 | 89% | |
Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 89% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | electron transport chain | GO:0022900 | Biological Process | 0.0 | 89% |
Blast2go | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | 89% |
Blast2go | acetyl-CoA biosynthetic process from pyruvate | GO:0006086 | Biological Process | 0.0 | 89% |
Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 89% |
Blast2go | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | 89% |
Blast2go | dihydrolipoyl dehydrogenase activity | GO:0004148 | Molecular Function | 0.0 | 89% |
Blast2go | disulfide oxidoreductase activity | GO:0015036 | Molecular Function | 0.0 | 89% |
Blast2go | nucleolus | GO:0005730 | Cellular Component | 0.0 | 89% |
Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | 89% |
Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 89% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
Sma3 | Mercuric reductase | IPR000815 | - | 0.0 | - |
Sma3 | Dihydrolipoamide dehydrogenase | IPR006258 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKS4
Fln msg: Distance to subject end: 274 aas, your sequence is shorter than subject: 63 - 576
Fln protein:
G
Protein Length:
64
Fln nts:
G
Fln Alignment:
uagpf_mira_c8541___GIEIDGKTVFTSDHALKLEWVPDWIAIIGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDP
B8LKS4________________GIEIDGKTVFTSDHALKLEWVPDWIAIIGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain