SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene27240

Length: 459 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>uagpf_v2_unigene27240
ATCGCAGTCTGAAGTCTTCACTTATCCACAGCACTGCCGCTACACTGATCCAAAGTTTAGGTGTACGTTATTACTGTGCTGAACATCGCCTTATAAAACTCCACTCATGAATACAAGCTTTTCGCCATGTCTCTCGAATCTGAATCCCTTCTAGCAGCAGAGTAGTCCGCTTGGACAAAAAATCAACAGTAATCCCATCTCGCCTATCGCAGCGCCAACATTGCAAGCTCTGCCCTTCCGATTTATGGATGCTCTACATCGATTACATTCAGAAGGGTCTCATCTACCAAATGCCCTTCGCCGATGATCACCATTTTATTTCGGCGGTGGAGCTTCTCAAGAAGAGCCTCGCTGAAGTCCTCGTCCATTTCTACCCCTTGGCAGGAAGGCTTATTACTTGGACTGCGTCGCCACGAGCCGATGAGCTTAAAGATCTGAGTGACAGCCAAGGTCACGACG

Ace file of the UniGene uagpf_v2_unigene27240 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene7838	8/8

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Anthocyanin 5-aromatic acyltransferase, putative n=1 Tax=Ricinus communis RepID=B9SLJ1_RICCO	-	-	3.0e-15	48%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	75%
Blast2go	bahd acyltransferase dcr	-	-	1.68156e-44	59%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Acyltransferases, Transferring groups other than amino-acyl groups.	EC:2.3.1.-	-	1.68156e-44	59%

Source	KEGGs	Term	e value	Identity
Blast2go	Fatty acid biosynthesis	00061	1.68156e-44	59%
Blast2go	Tetracycline biosynthesis	00253	1.68156e-44	59%
Blast2go	Lysine degradation	00310	1.68156e-44	59%
Blast2go	Arginine and proline metabolism	00330	1.68156e-44	59%
Blast2go	Histidine metabolism	00340	1.68156e-44	59%
Blast2go	Tyrosine metabolism	00350	1.68156e-44	59%
Blast2go	Benzoate degradation	00362	1.68156e-44	59%
Blast2go	Lipopolysaccharide biosynthesis	00540	1.68156e-44	59%
Blast2go	Glycerophospholipid metabolism	00564	1.68156e-44	59%
Blast2go	Ether lipid metabolism	00565	1.68156e-44	59%
Blast2go	Glycosphingolipid biosynthesis - ganglio series	00604	1.68156e-44	59%
Blast2go	Toluene degradation	00623	1.68156e-44	59%
Blast2go	Naphthalene degradation	00626	1.68156e-44	59%
Blast2go	Aminobenzoate degradation	00627	1.68156e-44	59%
Blast2go	Ethylbenzene degradation	00642	1.68156e-44	59%
Blast2go	Butanoate metabolism	00650	1.68156e-44	59%
Blast2go	Methane metabolism	00680	1.68156e-44	59%
Blast2go	Limonene and pinene degradation	00903	1.68156e-44	59%
Blast2go	Diterpenoid biosynthesis	00904	1.68156e-44	59%
Blast2go	Carotenoid biosynthesis	00906	1.68156e-44	59%
Blast2go	Anthocyanin biosynthesis	00942	1.68156e-44	59%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	1.68156e-44	59%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	1.68156e-44	59%
Blast2go	Tropane, piperidine and pyridine alkaloid biosynthesis	00960	1.68156e-44	59%
Blast2go	Betalain biosynthesis	00965	1.68156e-44	59%
Blast2go	Biosynthesis of unsaturated fatty acids	01040	1.68156e-44	59%
Blast2go	Biosynthesis of type II polyketide backbone	01056	1.68156e-44	59%
Blast2go	Biosynthesis of terpenoids and steroids	01062	1.68156e-44	59%
Blast2go	Metabolic pathways	01100	1.68156e-44	59%
Blast2go	Biosynthesis of secondary metabolites	01110	1.68156e-44	59%

Source	GOs	Term	Type	e value	Identity
Blast2go	transferase activity, transferring acyl groups other than amino-acyl groups	GO:0016747	Molecular Function	1.68156e-44	59%

Source	InterPros	Term	Type	e value	Identity
Sma3	Transferase	IPR003480	-	0.0	-

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LS40

Fln msg: Distance to subject end: 330 aas, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 105 - 440

Fln protein: IPSSSRVVRLDKKSTVIPSRLSQRQHCKLCPSDLWMLYIDYIQKGLIYQMPFADDHHFISAVELLKKSLAEVLVHFYPLAGRLITWTASPRADELKDLSDSQGHD

Protein Length: 106

Fln nts: ATCGCAGTCTGAAGTCTTCACTTATCCACAGCACTGCCGCTACACTGATCCAAAGTTTAGGTGTACGTTATTACTGTGCTGAACATCGCCTTATAAAACTCCACTCATGAATACAAGCTTTTCGCCATGTCTCTCGAATCTGAATCCCTTCTAGCAGCAGAGTAGTCCGCTTGGACAAAAAATCAACAGTAATCCCATCTCGCCTATCGCAGCGCCAACATTGCAAGCTCTGCCCTTCCGATTTATGGATGCTCTACATCGATTACATTCAGAAGGGTCTCATCTACCAAATGCCCTTCGCCGATGATCACCATTTTATTTCGGCGGTGGAGCTTCTCAAGAAGAGCCTCGCTGAAGTCCTCGTCCATTTCTACCCCTTGGCAGGAAGGCTTATTACTTGGACTGCGTCGCCACGAGCCGATGAGCTTAAAGATCTGAGTGACAGCCAAGGTCACGACG

Fln Alignment:

uagpf_mira_c5827___LDKKSTVIPSRLSQRQHCKLCPSDLWMLYIDYIQKGLIYQMPFADDHHFISAVELLKKSLAEVLVHFYPLAGRLIT
B8LS40________________LGRKSTVIPARPSQPQQCKLCPSDLQMLCCDYIQKGLLYHMPFA-DQHFVSLVELLKKSLSEALVWFYPLAGRLLT

SNPs (tot: 11)

Position	A %	C %	G %	T %	Probability
169	66	33			0.997452
170			66	33	0.997452
172			66	33	0.997454
177		33		66	0.997461
178	33			66	0.997461
183		25	75		0.99649
192		66		33	0.997452
208	66			33	0.997452
304		33		66	1.0
343			66	33	1.0
344	33	66			1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain