UniGene Name: uagpf_v2_unigene25149
Length: 235 nt
![]() |
---|
>uagpf_v2_unigene25149
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene975 | 4/4 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | nucleic acid binding / methyltransferase [Arabidopsis thaliana] gb|AAL25534.1| AT3g58470/F14P22_60 [Arabidopsis thaliana] gb|AAM91470.1| AT3g58470/F14P22_60 [Arabidopsis thaliana] gb|AEE79786.1| nucleic acid binding / methyltransferase [Arabidopsis thalia | - | - | 2.0e-29 | 56% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Blast2go | n -adenine-specific dna methyltransferase 2-like | - | - | 0.0 | 72% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 72% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 72% |
Blast2go | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | 72% |
Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 72% |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LMG3
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 76 - 249
Fln protein:
S
Protein Length:
77
Fln nts:
C
Fln Alignment:
uagpf_mira_c868___HSNNAFFLLLTGKVQQELAAKHLNARPCGFQPTHHHKLGNEFMLFTNYDPEERLGGWAEFN
B8LMG3________________NQKNAFFLLLTGKVQQELAAKLLNARPCGFQPTHHHKLGNEFMLFTNYDPEERLGGWVNFS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain