SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene17128

Length: 497 nt

UniGene Fasta

>uagpf_v2_unigene17128
CGTCGTGACCTTGGCTGTCACTCATTGTGGTTATGAAGATGGGATTCGAACATGTGACCAAAGAGATGATCAGAGAATTGATTAATGAGAGCGGAACGTGGTTTCTTTGTCTGTCGTCGACCTCTTCCTACAGTGTTCTTCTTCGTCTTCTTTCCAGGACGACTACAACGAGGGATTGGTTGAAGAAGTTAATGGGGAATGCCTGCAGTTCCTTCAGACTCTCAGAGATCATGGTGTTTTCGTGCATCGATGGTGATTGCATAGCAGGTAAGCACTATCACTACTACTATTATGACTACTAAATAATATTATAGAATAAAATGCTTGTTCGTCTTGGAGAGAGATTTGGCGGCAGCTGTCTGAGGTTGTGCCTGACGAATCCATGGCCGGTTCATTTATAATGTGCAAGTGTGTATTGGCTGTTAAGCATGATATATTAGCAGACTCCCATTATTATTTCTGTTAAGCATAATATATTAGCAGACTCCCAGTAAATT

Ace file of the UniGene uagpf_v2_unigene17128

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene1145	5/5

Source	Descriptions	Term	Type	e value	Identity
AutoFact	methyltransferase [Arabidopsis thaliana] emb\|CAB82287.1\| putative protein [Arabidopsis thaliana] gb\|AAL07072.1\| unknown protein [Arabidopsis thaliana] gb\|AAN13203.1\| unknown protein [Arabidopsis thaliana] gb\|AAN60352.1\| unknown [Arabidopsis thaliana] gb\|A	-	-	2.0e-38	26%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	84%
Blast2go	unknown [Picea sitchensis]	-	-	0.0	89%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring one-carbon groups, Methyltransferases.	EC:2.1.1.-	-	0.0	89%

Source	KEGGs	Term	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130	89%
Blast2go	Tetracycline biosynthesis	00253	89%
Blast2go	Histidine metabolism	00340	89%
Blast2go	Tyrosine metabolism	00350	89%
Blast2go	Phenylalanine metabolism	00360	89%
Blast2go	Tryptophan metabolism	00380	89%
Blast2go	Benzoxazinoid biosynthesis	00402	89%
Blast2go	Selenocompound metabolism	00450	89%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	89%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624	89%
Blast2go	Methane metabolism	00680	89%
Blast2go	Porphyrin and chlorophyll metabolism	00860	89%
Blast2go	Carotenoid biosynthesis	00906	89%
Blast2go	Phenylpropanoid biosynthesis	00940	89%
Blast2go	Flavonoid biosynthesis	00941	89%
Blast2go	Anthocyanin biosynthesis	00942	89%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	89%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	89%
Blast2go	Insect hormone biosynthesis	00981	89%
Blast2go	Biosynthesis of type II polyketide products	01057	89%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	89%
Blast2go	Metabolic pathways	01100	89%
Blast2go	Biosynthesis of secondary metabolites	01110	89%

Source	GOs	Term	Type	e value	Identity
Blast2go	methylation	GO:0032259	Biological Process	0.0	89%
Blast2go	methyltransferase activity	GO:0008168	Molecular Function	0.0	89%

Source	InterPros	Term	Type	e value	Identity
Sma3	Methyltransferase type 11	IPR013216	-	0.0	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5ADW7

Fln msg: Separated hits, possible frame ERROR between 104 and 119, Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 85 - 188

Fln protein: S*PWLSLIVVMKMGFEHVTKEMIRELINESGTWxxxxxxDLFLQCSSSSSFQDDYNEGLVEEVNGECLQFLQTLRDHGVFVHRW*

Protein Length: 86

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTGTGGTTATGAAGATGGGATTCGAACATGTGACCAAAGAGATGATCAGAGAATTGATTAATGAGAGCGGAACGTGGTTxxxxxxxxxxxxxxxCGACCTCTTCCTACAGTGTTCTTCTTCGTCTTCTTTCCAGGACGACTACAACGAGGGATTGGTTGAAGAAGTTAATGGGGAATGCCTGCAGTTCCTTCAGACTCTCAGAGATCATGGTGTTTTCGTGCATCGATGGTGATTGCATAGCAGGTAAGCACTATCACTACTACTATTATGACTACTAAATAATATTATAGAATAAAATGCTTGTTCGTCTTGGAGAGAGATTTGGCGGCAGCTGTCTGAGGTTGTGCCTGACGAATCCATGGCCGGTTCATTTATAATGTGCAAGTGTGTATTGGCTGTTAAGCATGATATATTAGCAGACTCCCATTATTATTTCTGTTAAGCATAATATATTAGCAGACTCCCAGTAAATT

Fln Alignment:

Contig17128___VVMKMGFEHVTKEMIRELINESGTWFxxxxxDLFLQCXXXXXFQDDYNEGLVEEVNGECLQFLQTLRDHGVFVHRW
D5ADW7________________VVMKMGFEHVTKEMIREMMIESGTGFxxxxxELFLQCSSSSS-QDDYNEGLIEEVNGECMQFLQTLRDHGVFVHRW

SNPs (tot: 11)

Position	A %	C %	G %	T %	Probability
121	20		80		0.995493
122	80			20	0.995493
130		20	20	60	0.99255
132		60	20	20	0.99255
133		80		20	0.995493
135			20	20	0.99255
136	80			20	0.995493
141		20	80		0.995493
143		20		80	0.995493
144	20	80			0.995493
452		66		33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain