SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene15867

Length: 515 nt

UniGene Fasta

>uagpf_v2_unigene15867
CGTCGTGACCTTGGCTGTACTCTTGTTATTCACTTGAAGCGCTTCAAGTACATTGAACAACTTGGGCGATACAAAAAGCTCTCTTATCGTGTGGTCTTCCCCATGGAGCTGAAGTTATGCAATACAACCGATGACGCACCGGGTTCAGATTCAGAGTATTCACTATTTGCAGTCGTTGTTCATGTTGGCAGTGGTCCAAATCATGGGCACTATATTAGCCTTGTAAAAAGCCATAACCACTGGCTCTTTTTTGATGACGAGAATGTAGAAATGATTGATGAGTCTGTTGTGCAAACATTTTTTGGTTCAGCACAGGAGTACTCAAACAACACGGATCATGGTTATATCTTGTTCTATGAGAGTCTAAACAACAAGCTTTGAGACATCCTTCATTGGATGAAATTTAGGGGATATATTTAGCTCGGAGTGCCAACGATTCAATTGGTTTTGGATGACTTGGAAATCCGAAAGCTGCAATACAGCTCATGTATCTTTTGAATTAGAATTAGAGTTTA

Ace file of the UniGene uagpf_v2_unigene15867

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene6320	29/31

Source	Descriptions	Term	Type	Identity
AutoFact	Ubiquitin carboxyl-terminal hydrolase n=3 Tax=Physcomitrella patens subsp. patens RepID=A9SFU8_PHYPA	-	-	85%
FL-Next	sp=Ubiquitin carboxyl-terminal hydrolase 3; Arabidopsis thaliana (Mouse-ear cress).	-	-	87%
Blast2go	protein	-	-	89%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	0.0	89%

Source	KEGGs	Term	Type	Identity
Blast2go	Fructose and mannose metabolism	00051		89%
Blast2go	N-Glycan biosynthesis	00510		89%
Blast2go	Mucin type O-Glycan biosynthesis	00512		89%
Blast2go	Various types of N-glycan biosynthesis	00513		89%
Blast2go	Other types of O-glycan biosynthesis	00514		89%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522		89%
Blast2go	Glycosaminoglycan biosynthesis - keratan sulfate	00533		89%
Blast2go	Lipopolysaccharide biosynthesis	00540		89%
Blast2go	Peptidoglycan biosynthesis	00550		89%
Blast2go	Glycerolipid metabolism	00561		89%
Blast2go	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563		89%
Blast2go	Sphingolipid metabolism	00600		89%
Blast2go	Glycosphingolipid biosynthesis - lacto and neolacto series	00601		89%
Blast2go	Glycosphingolipid biosynthesis - globo series	00603		89%
Blast2go	Glycosphingolipid biosynthesis - ganglio series	00604		89%
Blast2go	Carotenoid biosynthesis	00906		89%
Blast2go	Zeatin biosynthesis	00908		89%
Blast2go	Flavonoid biosynthesis	00941		89%
Blast2go	Anthocyanin biosynthesis	00942		89%
Blast2go	Flavone and flavonol biosynthesis	00944		89%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945		89%
Blast2go	Betalain biosynthesis	00965		89%
Blast2go	Biosynthesis of type II polyketide products	01057		89%
Blast2go	Metabolic pathways	01100		89%
Blast2go	Biosynthesis of secondary metabolites	01110		89%
Blast2go	Ubiquitin thiolesterase.	EC:3.1.2.15	-	89%

Source	GOs	Term	Type	Identity
Blast2go	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	89%
Blast2go	transferase activity, transferring hexosyl groups	GO:0016758	Molecular Function	89%
Blast2go	cysteine-type peptidase activity	GO:0008234	Molecular Function	89%
Blast2go	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	89%

Source	InterPros	Term	Type	e value	Identity
Sma3	Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site	IPR018200	-	0.0	-
Sma3	Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2	IPR001394	-	0.0	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: sp_plants

Fln subject: O24454

Fln msg: your sequence is shorter than subject: 127 - 371

Fln protein: RRDLGCTLVIHLKRFKYIEQLGRYKKLSYRVVFPMELKLCNTTDDAPGSDSEYSLFAVVVHVGSGPNHGHYISLVKSHNHWLFFDDENVEMIDESVVQTFFGSAQEYSNNTDHGYILFYESLNNKL*

Protein Length: 128

Fln nts: CGTCGTGACCTTGGCTGTACTCTTGTTATTCACTTGAAGCGCTTCAAGTACATTGAACAACTTGGGCGATACAAAAAGCTCTCTTATCGTGTGGTCTTCCCCATGGAGCTGAAGTTATGCAATACAACCGATGACGCACCGGGTTCAGATTCAGAGTATTCACTATTTGCAGTCGTTGTTCATGTTGGCAGTGGTCCAAATCATGGGCACTATATTAGCCTTGTAAAAAGCCATAACCACTGGCTCTTTTTTGATGACGAGAATGTAGAAATGATTGATGAGTCTGTTGTGCAAACATTTTTTGGTTCAGCACAGGAGTACTCAAACAACACGGATCATGGTTATATCTTGTTCTATGAGAGTCTAAACAACAAGCTTTGA___GACATCCTTCATTGGATGAAATTTAGGGGATATATTTAGCTCGGAGTGCCAACGATTCAATTGGTTTTGGATGACTTGGAAATCCGAAAGCTGCAATACAGCTCATGTATCTTTTGAATTAGAATTAGAGTTTA

Fln Alignment:

Contig15867___LVIHLKRFKYIEQLGRYKKLSYRVVFPMELKLCNTTDDAPGSDSEYSLFAVVVHVGSGPNHGHYISLVKSHNHWLFFDDENVEMIDESVVQTFFGSAQEYSNNTDHGYILFYESL
O24454________________LVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTVE--PYADVEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGYILFYESL

SNPs (tot: 38)

Position	A %	C %	G %	T %	Probability
21		66		33	0.997452
22	33			66	0.997452
26		33		66	0.997452
27	33		66		0.997452
76	75		25		0.996473
77	75			25	0.996473
78	75		25		0.996473
80		25	75		0.996473
83		75		25	0.996473
84			25	75	0.996473
85		75	25		0.996473
86		25		75	0.996473
88	75		25		0.996473
91	25		75		0.996473
92		25		75	0.996473
93			75	25	0.996473
94		25		75	0.996473
95	25		75		0.996473
319	86	13			0.999973
324			14	85	0.999981
325		85		14	0.999981
326	85		14		0.999981
328	85	14			0.999981
330	85			14	0.999981
331	85			14	0.999981
332		85	14		0.999981
333	85		14		0.999981
335			85	14	0.999981
342		14	85		0.999981
343	14		85		0.999981
375	86		13		1.0
376	86			13	1.0
379		13		86	1.0
385	86	13			1.0
386		86		13	1.0
387	86		13		1.0
392		13		86	1.0
393	13	86			1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain