SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene14079

Length: 526 nt

UniGene Fasta

>uagpf_v2_unigene14079
CGTCGTGACCTTGGCTGTCACTCAGGTTCACCGTCGTGACCTTGGCTGTCACTCATTATAGTCCCAGCTATGGCGCAACGTCGTGACCTATGGCCAACAATGAGGTTATTAGAGGATAGCCTGGCTGAAAAAATGCTTGCTGGTGAGATCAAAGAGGGGGATTCGGCTATAGTTGACGTGGATAGCGAAGGAAATGTTACTGTGTTGAATGGGAAGACTGGCACAGTAGGGCCGTCAGCCACTGCATTAGCTGCATAGAAAAAAGGTCTATTCATTTGAGTGGCTGGGCCAAATATTGGTCAACTTGGCTCCATCCTATTAAATGTAGGTAGTTATTAAATGACAGGATTTCTTTTGGGTTTCAATTTGATTTCTGAGTACTTGTTAGATGATGTTCTTTGTAAGTACCCTAGTTCTGAGCATCTAAAGTTGTAGGATATACATTGGATTGTTCTGAACTTTATTGAGATAATGAAAACTTTGAAATGTTGCAAGTATAAAAGAGATGTTAAGGTTGTACTAACTT

Ace file of the UniGene uagpf_v2_unigene14079

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene4965	15/18

Source	Descriptions	Term	Type	Identity
AutoFact	ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic n=3 Tax=core eudicotyledons RepID=CLPAB_SOLLC	-	-	80%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	94%
Blast2go	chaperone protein chloroplastic-like	-	-	92%

Source	GOs	Term	Type	Identity
Blast2go	nucleotide-excision repair	GO:0006289	Biological Process	92%
Blast2go	chloroplast organization	GO:0009658	Biological Process	92%
Blast2go	protein import into chloroplast stroma	GO:0045037	Biological Process	92%
Blast2go	regulation of chlorophyll biosynthetic process	GO:0010380	Biological Process	92%
Blast2go	protein metabolic process	GO:0019538	Biological Process	92%
Blast2go	ATP-dependent peptidase activity	GO:0004176	Molecular Function	92%
Blast2go	DNA binding	GO:0003677	Molecular Function	92%
Blast2go	nuclease activity	GO:0004518	Molecular Function	92%
Blast2go	ATP binding	GO:0005524	Molecular Function	92%
Blast2go	Tic complex	GO:0031897	Cellular Component	92%
Blast2go	cell wall	GO:0005618	Cellular Component	92%
Blast2go	chloroplast stroma	GO:0009570	Cellular Component	92%
Blast2go	chloroplast thylakoid membrane	GO:0009535	Cellular Component	92%
Blast2go	mitochondrion	GO:0005739	Cellular Component	92%

Source	InterPros	Term	Type	Identity
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-2	IPR013093	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	Chaperonin ClpA/B, conserved site	IPR018368	-	-
Sma3	Chaperonin ClpA/B	IPR001270	-	-
Sma3	Clp, N-terminal	IPR004176	-	-
Sma3	UVR domain	IPR001943	-	-

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AEG2

Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 86 - 323

Fln protein: RRDLGCHSGSPS*PWLSLIIVPAMAQRRDLWPTMRLLEDSLAEKMLAGEIKEGDSAIVDVDSEGNVTVLNGKTGTVGPSATALAA*

Protein Length: 87

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGGTTCACCGTCGTGACCTTGGCTGTCACTCATTATAGTCCCAGCTATGGCGCAACGTCGTGACCTATGGCCAACAATGAGGTTATTAGAGGATAGCCTGGCTGAAAAAATGCTTGCTGGTGAGATCAAAGAGGGGGATTCGGCTATAGTTGACGTGGATAGCGAAGGAAATGTTACTGTGTTGAATGGGAAGACTGGCACAGTAGGGCCGTCAGCCACTGCATTAGCTGCATAG___AAAAAAGGTCTATTCATTTGAGTGGCTGGGCCAAATATTGGTCAACTTGGCTCCATCCTATTAAATGTAGGTAGTTATTAAATGACAGGATTTCTTTTGGGTTTCAATTTGATTTCTGAGTACTTGTTAGATGATGTTCTTTGTAAGTACCCTAGTTCTGAGCATCTAAAGTTGTAGGATATACATTGGATTGTTCTGAACTTTATTGAGATAATGAAAACTTTGAAATGTTGCAAGTATAAAAGAGATGTTAAGGTTGTACTAACTT

Fln Alignment:

Contig14079___MRLLEDSLAEKMLAGEIKEGDSAIVDVDSEGNVTVLNGKTGTVGPSATALAA
D5AEG2________________MRLLEDSLAEKMLAGEIKEGDSAIVDVDGEGNVIVLNGKTGTAGPSATALAA

SNPs (tot: 41)

Position	A %	C %	G %	T %	Probability
32	33	66			0.997452
34	33			66	0.997452
37		33		66	0.997452
41		66	33		0.997452
45			66	33	0.997452
46	33	66			0.997452
47			33	66	0.997452
48	33		66		0.997452
50		66	33		0.997452
53	33			66	0.997452
54		66	33		0.997452
55	66		33		0.997452
79		40	60		1.0
81		40		60	1.0
83	40		60		1.0
84		40		60	1.0
85			40	60	1.0
86	40	60			1.0
88		40	60		1.0
91			40	60	1.0
95	40			60	1.0
96	60		40		1.0
98		40		60	1.0
102		40	60		1.0
121		71	14	14	0.984337
122		14		85	0.993533
123	5	27	66		1.0
125		72		22	1.0
126		22		77	1.0
128	61			27	1.0
129	72	5	22		1.0
131	66	33			1.0
132	66	22		11	1.0
133	55			27	1.0
136		72	22	5	1.0
137		22		77	1.0
143	22		77		1.0
144		22	77		1.0
146	11	11	77		0.999842
166	44		55		1.0
400		53		46	1.0

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain