UniGene Name: uagpf_v2_unigene10975
Length: 224 nt
UniGene Fasta |
---|
>uagpf_v2_unigene10975
C |
Ace file of the UniGene uagpf_v2_unigene10975 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Parent Assembly | Parent UniGene | Reads (related/total) |
---|---|---|
SustainPine v2.0 | sp_v2.0_unigene7421 | 2/2 |
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP-binding cassette transporter, subfamily B, member 10, group ATM protein PpABCB10 n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TV53_PHYPA | - | - | 0.0 | 77% |
FL-Next | tr=ATP-binding cassette transporter, subfamily B, member 10, group ATM protein PpABCB10; Physcomitrella patens subsp. patens (Moss). | - | - | 0.0 | 56% |
Blast2go | abc transporter-like protein | - | - | 0.0 | 80% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 0.0 | 80% |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Blast2go | root development | GO:0048364 | Biological Process | 0.0 | 80% |
Blast2go | Mo-molybdopterin cofactor biosynthetic process | GO:0006777 | Biological Process | 0.0 | 80% |
Blast2go | positive regulation of catalytic activity | GO:0043085 | Biological Process | 0.0 | 80% |
Blast2go | cellular iron ion homeostasis | GO:0006879 | Biological Process | 0.0 | 80% |
Blast2go | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | 80% |
Blast2go | pollen development | GO:0009555 | Biological Process | 0.0 | 80% |
Blast2go | chloroplast organization | GO:0009658 | Biological Process | 0.0 | 80% |
Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 80% |
Blast2go | response to lead ion | GO:0010288 | Biological Process | 0.0 | 80% |
Blast2go | transmembrane transport | GO:0055085 | Biological Process | 0.0 | 80% |
Blast2go | ATP catabolic process | GO:0006200 | Biological Process | 0.0 | 80% |
Blast2go | regulation of multicellular organism growth | GO:0040014 | Biological Process | 0.0 | 80% |
Blast2go | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | 80% |
Blast2go | enzyme activator activity | GO:0008047 | Molecular Function | 0.0 | 80% |
Blast2go | motor activity | GO:0003774 | Molecular Function | 0.0 | 80% |
Blast2go | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | 80% |
Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 80% |
Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | 80% |
Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 80% |
Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 80% |
Blast2go | myosin complex | GO:0016459 | Cellular Component | 0.0 | 80% |
Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: A9TV53
Fln msg: your sequence is shorter than subject: 50 - 479
Fln protein:
R
Protein Length:
51
Fln nts:
C
Fln Alignment:
Contig10975___VLDDGQIVEEGTHQNLLARKGIYAKMWSLQESQNDEKCSRV
A9TV53________________VMDAGVVVEEGTHQELLAKRGRYAHMWTLQESEETTKMIKI
SNPs (tot: 1) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
13 | 33 | 66 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain