UniGene Name: uagpf_v2_unigene10621
Length: 224 nt
UniGene Fasta
|
|---|
| >uagpf_v2_unigene10621
C |
Ace file of the UniGene uagpf_v2_unigene10621
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene11615 | 1/3 |
| SustainPine v2.0 | sp_v2.0_unigene63175 | 2/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | receptor-like protein kinase 1 [Glycine max] | - | - | 0.0 | 65% |
| FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 40% |
| Blast2go | receptor-like protein kinase | - | - | 0.0 | 77% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Beta-amylase. | EC:3.2.1.2 | - | 0.0 | 77% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Starch and sucrose metabolism | 00500 | 0.0 | 77% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 77% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | 77% |
| Blast2go | response to water deprivation | GO:0009414 | Biological Process | 0.0 | 77% |
| Blast2go | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | 77% |
| Blast2go | starch catabolic process | GO:0005983 | Biological Process | 0.0 | 77% |
| Blast2go | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | 77% |
| Blast2go | gametophyte development | GO:0048229 | Biological Process | 0.0 | 77% |
| Blast2go | beta-amylase activity | GO:0016161 | Molecular Function | 0.0 | 77% |
| Blast2go | protein self-association | GO:0043621 | Molecular Function | 0.0 | 77% |
| Blast2go | transferase activity | GO:0016740 | Molecular Function | 0.0 | 77% |
| Blast2go | receptor serine/threonine kinase binding | GO:0033612 | Molecular Function | 0.0 | 77% |
| Blast2go | chloroplast | GO:0009507 | Cellular Component | 0.0 | 77% |
| Blast2go | cytosol | GO:0005829 | Cellular Component | 0.0 | 77% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 77% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 77% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
| Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 456 aas, your sequence is shorter than subject: 74 - 998
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
Contig10621___SFSNLQILALDGNQFTRSIPPEIGHLKQLSKMDFSGNRFSGAIPPEISDCKHLAFIDLSRNELSGSI
Q19AV8________________NLTKLQNLWLAGCNLVGEIPETLGNLAELTNLDLSINRLSGSIPESITKLDKVAQIELYQNLLSGPI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta