SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene7930

Length: 361 nt

UniGene Fasta

>uagpf_v2_unigene7930
CGTCGTGACCTTGGCTGTCACTCAATTATATATAACATTGTTTGAGCGATTGAATGCACATCGTCGTGACCTTGGCTGTCACTCAGTTGATCTCCGAGTAGATCTTAATGGAGCTATTGAAGAGGAAAACATTCCGTTGCTGAGATCCTTGGATTCAGATTTAAAGGAAAAGCTGGCAACATGGTTGAGTCCAGCTGTCCTCGAACTCCATCGCATTACCTGGGATGATCCTGCATCTTTACTGGAGAAGATTGTGGCATATGAAGCTGTACATCCTATTAGCAACCTCCATGATTTGAAACGGAGATTGGGAGCAGGCCATCGCTGCTTTGGGTATCTGCATCCTGCCATACCAGGTGAG

Ace file of the UniGene uagpf_v2_unigene7930

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene8500	9/9

Source	Descriptions	Term	Type	Identity
AutoFact	malonyl-CoA decarboxylase [Arabidopsis thaliana] gb\|AAP40492.1\| putative malonyl-CoA decarboxylase [Arabidopsis thaliana] dbj\|BAF01557.1\| malonyl-CoA decarboxylase like protein [Arabidopsis thaliana] gb\|AEE82377.1\| malonyl-CoA decarboxylase [Arabidopsis t	-	-	61%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	87%
Blast2go	malonyl- decarboxylase	-	-	75%

Source	ECs	Term	Type	e value	Identity
Blast2go	Oxidoreductases, Acting on single donors with incorporation of molecular oxygen, With incorporation of two atoms of oxygen.	EC:1.13.11.-	-	0.0	75%

Source	KEGGs	Term	Type	Identity
Blast2go	Benzoate degradation	00362		75%
Blast2go	Tryptophan metabolism	00380		75%
Blast2go	Arachidonic acid metabolism	00590		75%
Blast2go	Xylene degradation	00622		75%
Blast2go	Toluene degradation	00623		75%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624		75%
Blast2go	Naphthalene degradation	00626		75%
Blast2go	Aminobenzoate degradation	00627		75%
Blast2go	Nitrotoluene degradation	00633		75%
Blast2go	Betalain biosynthesis	00965		75%
Blast2go	Metabolic pathways	01100		75%
Blast2go	Malonyl-CoA decarboxylase.	EC:4.1.1.9	-	75%

Source	KEGGs	Term	Identity
Blast2go	beta-Alanine metabolism	00410	75%
Blast2go	Propanoate metabolism	00640	75%
Blast2go	Metabolic pathways	01100	75%

Source	GOs	Term	Type	Identity
Blast2go	fatty acid biosynthetic process	GO:0006633	Biological Process	75%
Blast2go	macromolecule metabolic process	GO:0043170	Biological Process	75%
Blast2go	protein kinase activity	GO:0004672	Molecular Function	75%
Blast2go	metal ion binding	GO:0046872	Molecular Function	75%
Blast2go	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	GO:0016702	Molecular Function	75%
Blast2go	nucleotide binding	GO:0000166	Molecular Function	75%
Blast2go	malonyl-CoA decarboxylase activity	GO:0050080	Molecular Function	75%
Blast2go	peroxisome	GO:0005777	Cellular Component	75%

Source	InterPros	Term	Type	Identity
Sma3	CDP-alcohol phosphatidyltransferase	IPR000462	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Peptidoglycan-binding Lysin subgroup	IPR002482	-	-
Sma3	Malonyl-CoA decarboxylase	IPR007956	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Peptidoglycan-binding lysin domain	IPR018392	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LMR4

Fln msg: Distance to subject end: 261 aas, your sequence is shorter than subject: 120 - 522

Fln protein: VVTLAVTQLYITLFERLNAHRRDLGCHSVDLRVDLNGAIEEENIPLLRSLDSDLKEKLATWLSPAVLELHRITWDDPASLLEKIVAYEAVHPISNLHDLKRRLGAGHRCFGYLHPAIPGE

Protein Length: 121

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTATATATAACATTGTTTGAGCGATTGAATGCACATCGTCGTGACCTTGGCTGTCACTCAGTTGATCTCCGAGTAGATCTTAATGGAGCTATTGAAGAGGAAAACATTCCGTTGCTGAGATCCTTGGATTCAGATTTAAAGGAAAAGCTGGCAACATGGTTGAGTCCAGCTGTCCTCGAACTCCATCGCATTACCTGGGATGATCCTGCATCTTTACTGGAGAAGATTGTGGCATATGAAGCTGTACATCCTATTAGCAACCTCCATGATTTGAAACGGAGATTGGGAGCAGGCCATCGCTGCTTTGGGTATCTGCATCCTGCCATACCAGGTGAG

Fln Alignment:

Contig7930___AVTQLYITLFERLNAHRRDLGCHSVDLRVDLNGAIEEENIPLLRSLDSDLKEKLATWLSPAVLELHRITWDDPASLLEKIVAYEAVHPISNLHDLKRRLGAGHRCFGYLHPAIPGE
B8LMR4_______________ALKPLYITLFERLNAHPGGLK-FLVDLRIDLNGAIQEENIPSLRSLDSDLKEKLATWLSPAVLELHRITWDDPASLLEKIVAYEAVHPISNLHDLKRRLGGGYRCFGYLHPAIPGE

SNPs (tot: 9)

Position	A %	C %	G %	T %	Probability
63		42	57		1.0
65		57	42		1.0
70		57	42		1.0
76	42	57			1.0
77	42			57	1.0
81	57			42	1.0
84		57		42	1.0
85	57		42		1.0
118		11		88	0.923564

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain