SustainPineDB

Assembly Name: uagpf v2.0

UniGene Name: uagpf_v2_unigene7495

Length: 1426 nt

UniGene Fasta

Ace file of the UniGene uagpf_v2_unigene7495

Annotations

Parent Assembly	Parent UniGene	Reads (related/total)
SustainPine v2.0	sp_v2.0_unigene5211	48/58
SustainPine v2.0	sp_v2.0_unigene18827	7/58

Source	Descriptions	Term	Type	Identity
AutoFact	Jasmonate O-methyltransferase, putative n=1 Tax=Ricinus communis RepID=B9R7Y1_RICCO	-	-	41%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	62%
Blast2go	jasmonate o-methyltransferase	-	-	60%

Source	ECs	Term	Type	e value	Identity
Blast2go	Transferases, Transferring one-carbon groups, Methyltransferases.	EC:2.1.1.-	-	0.0	60%

Source	KEGGs	Term	Identity
Blast2go	Ubiquinone and other terpenoid-quinone biosynthesis	00130	60%
Blast2go	Tetracycline biosynthesis	00253	60%
Blast2go	Histidine metabolism	00340	60%
Blast2go	Tyrosine metabolism	00350	60%
Blast2go	Phenylalanine metabolism	00360	60%
Blast2go	Tryptophan metabolism	00380	60%
Blast2go	Benzoxazinoid biosynthesis	00402	60%
Blast2go	Selenocompound metabolism	00450	60%
Blast2go	Biosynthesis of 12-, 14- and 16-membered macrolides	00522	60%
Blast2go	Polycyclic aromatic hydrocarbon degradation	00624	60%
Blast2go	Methane metabolism	00680	60%
Blast2go	Porphyrin and chlorophyll metabolism	00860	60%
Blast2go	Carotenoid biosynthesis	00906	60%
Blast2go	Phenylpropanoid biosynthesis	00940	60%
Blast2go	Flavonoid biosynthesis	00941	60%
Blast2go	Anthocyanin biosynthesis	00942	60%
Blast2go	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945	60%
Blast2go	Isoquinoline alkaloid biosynthesis	00950	60%
Blast2go	Insect hormone biosynthesis	00981	60%
Blast2go	Biosynthesis of type II polyketide products	01057	60%
Blast2go	Biosynthesis of alkaloids derived from shikimate pathway	01063	60%
Blast2go	Metabolic pathways	01100	60%
Blast2go	Biosynthesis of secondary metabolites	01110	60%

Source	GOs	Term	Type	e value	Identity
Blast2go	methylation	GO:0032259	Biological Process	0.0	60%
Blast2go	methyltransferase activity	GO:0008168	Molecular Function	0.0	60%

Source	InterPros	Term	Type	e value	Identity
Sma3	SAM dependent carboxyl methyltransferase	IPR005299	-	0.0	-

Full-Lengther Next Prediction

Fln status: Complete

Fln database: coniferopsida.fasta

Fln subject: B8LNJ2

Fln msg: Overlapping hits, possible frame ERROR between 746 and 595,

Fln protein: MERVLHMNAGIGDCSYAQNSFLQRRGSDNVKPILEETLLSMKMMMECCNTFRIADLGCSSSPNALFTAQNITNTLKAKYTAAGISLPQFQVFFNDLPASDFNSLFGILPSFSLNTDNHNEEEAVDRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIFCHGGSRAVGEAYFLQFQRDFNTFLRSRAEEMVGGGRMFLLLLGRTPHDPTDQGPVGLAFKLLGTSLNELVNQGFIEEEKVDSFNIPIYYPCPEEVSNEIAKEGSFEVQRLELLRRTENVPKEKLEAITGSASAKGKTLSKQIRAALESLMKHHFGEEIIVALFEKYGEIMARRWSDFIEYAEKGGDLVIVLQRK*

Protein Length: 377

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATTGTTTAATGAAGTCATTGGTTTCATTTGGTACTTAAAGGACTATTTTATTGGTTTAATTTGTGATAGCACGAGAAAGTTGAATTGGACGTCCATGGCCTTGCTGGAAAATATTGTTTAATGAAGTTGTTGGTTTCATTTCCTATTTAAAGGAGTATTTTGTTGGTTTGATTTGTGATTCCAAGGAG_-_ATGGAGAGAGTGCTGCATATGAACGCTGGCATCGGAGATTGCAGCTATGCTCAAAATTCTTTCTTGCAGAGGAGAGGATCAGACAATGTAAAGCCTATTTTGGAGGAAACCCTTTTATCTATGAAGATGATGATGGAATGCTGCAACACGTTTCGCATTGCGGACCTCGGTTGTTCGTCCAGCCCCAATGCTCTCTTCACCGCCCAAAATATAACAAACACCCTCAAAGCCAAATATACGGCTGCGGGAATTTCTCTTCCGCAGTTTCAAGTGTTCTTTAACGATCTTCCGGCTTCTGATTTTAACTCGCTATTTGGAATTTTGCCTTCTTTTTCACTAAATACTGATAATCACAATGAAGAGGAAGCCGTAGATAGATCGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxATCTTTTGCCATGGCGGATCTCGGGCAGTCGGCGAAGCGTATTTTCTTCAATTTCAGAGGGATTTCAACACGTTTCTGAGATCCCGTGCAGAGGAGATGGTTGGCGGGGGCCGCATGTTTTTGCTGTTACTGGGTCGAACACCTCACGATCCAACTGATCAGGGTCCTGTCGGCCTCGCCTTCAAATTATTAGGAACCAGTTTGAATGAATTGGTAAATCAGGGTTTTATCGAGGAGGAGAAGGTGGACTCGTTCAACATCCCCATATATTATCCATGTCCAGAGGAAGTAAGCAATGAAATAGCGAAAGAGGGTTCATTCGAAGTACAACGACTGGAGCTTCTGAGACGAACAGAAAATGTTCCGAAAGAGAAATTGGAAGCCATAACAGGCTCAGCCTCTGCAAAGGGTAAAACCCTGTCAAAGCAAATAAGAGCAGCGTTGGAAAGTCTAATGAAACACCATTTTGGAGAAGAAATAATTGTTGCGTTGTTCGAGAAATATGGAGAAATAATGGCGAGGAGATGGAGTGATTTCATCGAATATGCAGAGAAGGGAGGAGATCTCGTTATCGTCCTGCAGCGTAAATGA___AAGCTCTAGTGATGTTGAAAAATAAAGGACGGCTCTATAAATCTGTCCCTATTTTTGGGGCAATTTGTCAGTGTCCGAGTTTCAATGC

Fln Alignment:

Contig7495___EMERVLHMNAGIGDCSYAQNSFL-QRRGSDNVKPILEETLLSMKMMMECCNTFRIADLGCSSSPNALFTAQNITNTLKAKYTAAGISLPQFQVFFNDLPASDFNSLFGILPSFSLNTDNHNEEExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIFCHGGSRAVGEAYFLQFQRDFNTFLRSRAEEMVXXXXXXXXXXXXTPHDPTDQGPVGLAFKLLGTSLNELVNQGFIEEEKVDSFNIPIYYPCPEEVSNEIAKEGSFEVQRLELLRRTENVPKEKLEAITGSASAK---GKTLSKQIRAALESLMKHHFGEEIIVALFEKYGEIMARRWSDFIEYAEKGGDLVIVLQRK
B8LNJ2_______________EMERVFRMNAGLGDSSYAQNSILLQRRGLEIVEPVLEEAILSMKMMSEF-NTFCIADLGCSSGPNALFTAENITKTLKAKYMSAGIPVPQCQ----------------------------NEEGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIFCGGESQAVGEAYFRQFQKDFNTFLRARADEMVGGGRMLLLLLGRTPHDPIDQGYIALQWELLEISLNDLVKQGLIEEEKVDSFNIPMYCPCPGEVSNEIAREGSFEIQRLELLRRSENFPREEMEAITGSASAKDAYGQKLAKQLRAVMESLMKHHFGEEIMDALFERYGEILGRRLSERIEYGKRGGYLVLVLQRR

SNPs (tot: 107)

Position	A %	C %	G %	T %	Probability
48		25		75	1.0
61	75			25	1.0
67		75	25		1.0
106			75	25	1.0
121		25	75		1.0
166		71	28		1.0
260		25		75	0.996473
473	25			75	0.996473
476			75	25	0.996473
477		75		25	0.996473
478	75		25		0.996473
482			33	66	0.997452
486	66	33			0.997452
487			66	33	0.997452
488		33		66	0.997452
489	33		66		0.997452
526		75		25	0.996473
527			25	75	0.996473
528	50	50			1.0
529		25		75	0.996473
535	75	25			0.996473
537			25	75	0.996473
539		25		75	0.996473
540	25		75		0.996473
545		75		25	0.996473
612			14	85	0.993533
692		75		25	0.996473
725	80		20		0.995493
737	80		20		0.995493
746	20		80		0.995493
747		20	80		0.995493
764		16		83	0.994512
766			83	16	0.994512
771		16		83	0.994512
772		83	16		0.994512
775			83	16	0.994512
779	83			16	0.994512
784	16		83		0.994512
786			83	16	0.994512
787	83	16			0.994512
799			16	83	0.994512
803	83		16		0.994512
805			20	80	0.995493
806	20			80	0.995493
809		20	80		0.995493
810	80			20	0.995493
811	20		60	20	0.99255
814	80	20			0.995493
816			20	80	0.995493
822	80			20	0.995493
824	20		80		0.995493
848		20	80		0.995493
849	80		20		0.995493
851		20	80		0.995493
856	20		80		0.995493
858		20	80		0.995493
859			80	20	0.995493
860			80	20	0.995493
864		75		25	0.996473
872	25		75		0.996473
885	50	50			1.0
898		66	33		1.0
901	66		33		1.0
902		66		33	1.0
905		33		66	1.0
908		66		33	1.0
909	66		33		1.0
910	66		33		1.0
918	16		66		0.988813
919		14	85		0.993533
923	42	42	14		1.0
926	14			85	0.993533
928			85	14	0.993533
930		85	14		0.993533
933		85	14		0.993533
934			71	28	1.0
936	14	85			0.993533
937		14		85	0.993533
955	70	30			1.0
958			30	70	1.0
963	70	30			1.0
965			70	30	1.0
966	70		30		1.0
967	70		30		1.0
968		20		80	0.999996
973	70	30			1.0
975	70	30			1.0
1027	90	10			0.90298
1028			10	90	0.90298
1029		10		90	0.90298
1043		10	90		0.90298
1045	90			10	0.90298
1046	90	10			0.90298
1049	90		10		0.90298
1051		10	90		0.90298
1053	90			10	0.90298
1054	90			10	0.90298
1055			10	90	0.90298
1057	90	10			0.90298
1058	90			10	0.90298
1059	90		10		0.90298
1061	90	10			0.90298
1062	10		90		0.90298
1147	15	84			0.999986
1198		81		18	1.0
1337		30	70		1.0
1355		87		12	0.992554

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain