|
||||||
|
UniGene Name: biog3_v1.0_unigene26077
Length: 240 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene26077
G |
|
Ace file of the UniGene biog3_v1.0_unigene26077 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene64044 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glutamate dehydrogenase n=4 Tax=Pinaceae RepID=D9IXC9_PINPS | - | - | 0.0 | 79% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Blast2go | glutamate dehydrogenase | - | - | 0.0 | 85% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glutamate dehydrogenase. | EC:1.4.1.2 | - | 0.0 | 85% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 85% | |
| Blast2go | Arginine and proline metabolism | 00330 | 0.0 | 85% | |
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 85% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 85% | |
| Blast2go | Glutamate dehydrogenase (NAD(P)(+)). | EC:1.4.1.3 | - | 0.0 | 85% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | 85% | |
| Blast2go | Arginine and proline metabolism | 00330 | 0.0 | 85% | |
| Blast2go | D-Glutamine and D-glutamate metabolism | 00471 | 0.0 | 85% | |
| Blast2go | Nitrogen metabolism | 00910 | 0.0 | 85% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 85% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 85% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | response to salt stress | GO:0009651 | Biological Process | 0.0 | 85% |
| Blast2go | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | 85% |
| Blast2go | copper ion binding | GO:0005507 | Molecular Function | 0.0 | 85% |
| Blast2go | glutamate dehydrogenase (NAD+) activity | GO:0004352 | Molecular Function | 0.0 | 85% |
| Blast2go | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | 85% |
| Blast2go | cobalt ion binding | GO:0050897 | Molecular Function | 0.0 | 85% |
| Blast2go | glutamate dehydrogenase [NAD(P)+] activity | GO:0004353 | Molecular Function | 0.0 | 85% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 85% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 85% |
| Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | 85% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamate/phenylalanine/leucine/valine dehydrogenase | IPR006095 | - | 0.0 | - |
| Sma3 | Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal | IPR006096 | - | 0.0 | - |
| Sma3 | Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation domain | IPR006097 | - | 0.0 | - |
| Sma3 | Glutamate dehydrogenase | IPR014362 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Formate C-acetyltransferase glycine radical, conserved site | IPR019777 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NXM5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 277 aas, your sequence is shorter than subject: 77 - 411
Fln protein:
V
Protein Length:
78
Fln nts:
G
Fln Alignment:
biogeco3_mira_rep_c29868___VQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCSPSSLSKTELERLTRVFTQK
A9NXM5__________________VQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCDPRSLSISELERLTRVFTQK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
