|
||||||
|
UniGene Name: biog3_v1.0_unigene25439
Length: 224 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene25439
A |
|
Ace file of the UniGene biog3_v1.0_unigene25439
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene6027 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aminophospholipid ATPase n=3 Tax=Populus trichocarpa RepID=B9MWV5_POPTR | - | - | 0.0 | 76% |
| FL-Next | sp=Phospholipid-transporting ATPase 6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 62% |
| Blast2go | aminophospholipid atpase | - | - | 0.0 | 85% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 0.0 | 85% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | 85% |
| Blast2go | phospholipid transport | GO:0015914 | Biological Process | 0.0 | 85% |
| Blast2go | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | 85% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 85% |
| Blast2go | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | 85% |
| Blast2go | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | 85% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 85% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 85% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SET domain | IPR001214 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | PIK-related kinase, FAT | IPR003151 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Somatotropin hormone, conserved site | IPR018116 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Sma3 | Formate C-acetyltransferase glycine radical, conserved site | IPR019777 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SLK6
Fln msg: Distance to subject end: 400 aas, your sequence is shorter than subject: 74 - 1240
Fln protein:
M
Protein Length:
75
Fln nts:
A
Fln Alignment:
biogeco3_mira_c27445___IGFACSLLRQGMKQICLTLKGIEFGNQDTSTKAAKESIILQMTNAYQTISLEMNPDAAFALIIEGKALAYAL
Q9SLK6__________________IGYACSLLRQGMKQISISLTNVEESSQN-SEAAAKESILMQITNASQMIKIEKDPHAAFALIIDGKTLTYAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
