UniGene Name: biog3_v1.0_unigene25226
Length: 247 nt
UniGene Fasta
|
|---|
| >biog3_v1.0_unigene25226
A |
Ace file of the UniGene biog3_v1.0_unigene25226
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene26432 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin-60S ribosomal protein L40-1 n=69 Tax=Eukaryota RepID=RL40A_ARATH | - | - | 0.0 | 99% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Blast2go | ubiquitin a-52 residue ribosomal protein fusion product 1 | - | - | 0.0 | 98% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | viral reproduction | GO:0016032 | Biological Process | 0.0 | 98% |
| Blast2go | negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle | GO:0051436 | Biological Process | 0.0 | 98% |
| Blast2go | MyD88-independent toll-like receptor signaling pathway | GO:0002756 | Biological Process | 0.0 | 98% |
| Blast2go | regulation of signal transduction | GO:0009966 | Biological Process | 0.0 | 98% |
| Blast2go | transmembrane receptor protein tyrosine kinase signaling pathway | GO:0007169 | Biological Process | 0.0 | 98% |
| Blast2go | translational elongation | GO:0006414 | Biological Process | 0.0 | 98% |
| Blast2go | anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process | GO:0031145 | Biological Process | 0.0 | 98% |
| Blast2go | induction of apoptosis by extracellular signals | GO:0008624 | Biological Process | 0.0 | 98% |
| Blast2go | anti-apoptosis | GO:0006916 | Biological Process | 0.0 | 98% |
| Blast2go | reproductive process | GO:0022414 | Biological Process | 0.0 | 98% |
| Blast2go | MyD88-dependent toll-like receptor signaling pathway | GO:0002755 | Biological Process | 0.0 | 98% |
| Blast2go | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | 98% |
| Blast2go | interphase of mitotic cell cycle | GO:0051329 | Biological Process | 0.0 | 98% |
| Blast2go | positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle | GO:0051437 | Biological Process | 0.0 | 98% |
| Blast2go | cellular membrane organization | GO:0016044 | Biological Process | 0.0 | 98% |
| Blast2go | cellular response to stress | GO:0033554 | Biological Process | 0.0 | 98% |
| Blast2go | MAPK cascade | GO:0000165 | Biological Process | 0.0 | 98% |
| Blast2go | multicellular organismal process | GO:0032501 | Biological Process | 0.0 | 98% |
| Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 98% |
| Blast2go | nucleoplasm | GO:0005654 | Cellular Component | 0.0 | 98% |
| Blast2go | cytosolic large ribosomal subunit | GO:0022625 | Cellular Component | 0.0 | 98% |
| Blast2go | endosome membrane | GO:0010008 | Cellular Component | 0.0 | 98% |
| Blast2go | nucleolus | GO:0005730 | Cellular Component | 0.0 | 98% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein L40e | IPR001975 | - | 0.0 | - |
| Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LP57
Fln msg: your sequence is shorter than subject: 46 - 128
Fln protein:
N
Protein Length:
47
Fln nts:
A
Fln Alignment:
biogeco3_mira_c27159___VIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKR
B8LP57__________________IIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta