|
||||||
|
UniGene Name: biog3_v1.0_unigene25218
Length: 238 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene25218
C |
|
Ace file of the UniGene biog3_v1.0_unigene25218
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene27342 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Myosin class 11-1 n=1 Tax=Adiantum capillus-veneris RepID=Q5NTX1_ADICA | - | - | 0.0 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 70% |
| Blast2go | protein | - | - | 0.0 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: A5ARX4
Fln msg: Separated hits, possible frame ERROR between 83 and 85, your sequence is shorter than subject: 75 - 1594
Fln protein:
H
Protein Length:
76
Fln nts:
C
Fln Alignment:
biogeco3_mira_c27149___HSVSPDVIASMKMLMAEDSNDAHGNSFxVDDDLSIPFSVDDISKSMQETDLSDINPPSQLLENSAFHFLLP
A5ARX4__________________HSVSPDVISNMRVLMTEDSNNAVSNSFxLDDDSSIPFSVDDISKSMEQIDISDIEPPPLIRENSGFSFLLP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
