|
||||||
|
UniGene Name: biog3_v1.0_unigene24975
Length: 166 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene24975
A |
|
Ace file of the UniGene biog3_v1.0_unigene24975
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4279 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aspartate kinase, putative n=1 Tax=Ricinus communis RepID=B9SHP2_RICCO | - | - | 0.0 | 68% |
| FL-Next | sp=Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic; Zea mays (Maize). | - | - | 0.0 | 67% |
| Blast2go | bifunctional aspartokinase homoserine dehydrogenase 1 | - | - | 0.0 | 80% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Homoserine dehydrogenase. | EC:1.1.1.3 | - | 0.0 | 80% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycine, serine and threonine metabolism | 00260 | 0.0 | 80% | |
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 80% | |
| Blast2go | Lysine biosynthesis | 00300 | 0.0 | 80% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 80% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 80% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 80% | |
| Blast2go | Aspartate kinase. | EC:2.7.2.4 | - | 0.0 | 80% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Glycine, serine and threonine metabolism | 00260 | 0.0 | 80% | |
| Blast2go | Cysteine and methionine metabolism | 00270 | 0.0 | 80% | |
| Blast2go | Lysine biosynthesis | 00300 | 0.0 | 80% | |
| Blast2go | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | 80% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 80% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 80% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 80% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | methionine biosynthetic process | GO:0009086 | Biological Process | 0.0 | 80% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 80% |
| Blast2go | phosphorylation | GO:0016310 | Biological Process | 0.0 | 80% |
| Blast2go | homoserine dehydrogenase activity | GO:0004412 | Molecular Function | 0.0 | 80% |
| Blast2go | aspartate kinase activity | GO:0004072 | Molecular Function | 0.0 | 80% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 80% |
| Blast2go | amino acid binding | GO:0016597 | Molecular Function | 0.0 | 80% |
| Blast2go | NADP binding | GO:0050661 | Molecular Function | 0.0 | 80% |
| Blast2go | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | 80% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aspartate/glutamate/uridylate kinase | IPR001048 | - | 0.0 | - |
| Sma3 | Aspartate kinase domain | IPR001341 | - | 0.0 | - |
| Sma3 | Homoserine dehydrogenase, catalytic | IPR001342 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Amino acid-binding ACT | IPR002912 | - | 0.0 | - |
| Sma3 | Aspartate/homoserine dehydrogenase, NAD-binding | IPR005106 | - | 0.0 | - |
| Sma3 | Bifunctional aspartokinase/homoserine dehydrogenase I | IPR011147 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Aspartate kinase, conserved site | IPR018042 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P49079
Fln msg: Distance to subject end: 626 aas, your sequence is shorter than subject: 54 - 920
Fln protein:
C
Protein Length:
55
Fln nts:
A
Fln Alignment:
biogeco3_mira_c26824___REVLVVNPTSSNQADPDYAASEENLNKWYSHTPAKTIIATGFM
P49079__________________REVLVVNPSGANQVDPDYLESEKRLEKWFSRCPAETIIATGFI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
