UniGene Name: biog3_v1.0_unigene24163
Length: 239 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene24163
A |
Ace file of the UniGene biog3_v1.0_unigene24163 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1178 | 3/3 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 6-phosphogluconate dehydrogenase NAD-binding domain-containing protein [Musa acuminata] | - | - | 0.0 | 55% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
| Blast2go | protein | - | - | 0.0 | 68% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Oxidoreductases, Acting on the CH-OH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.1.1.- | - | 0.0 | 68% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 68% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 68% |
| Blast2go | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | 68% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tyrosinase | IPR002227 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | 6-phosphogluconate dehydrogenase, NADP-binding | IPR006115 | - | 0.0 | - |
| Sma3 | IPR006183 | - | 0.0 | - | |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | 3-hydroxyacid dehydrogenase/reductase | IPR015815 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NZ37
Fln msg: your sequence is shorter than subject: 70 - 300
Fln protein:
N
Protein Length:
71
Fln nts:
A
Fln Alignment:
biogeco3_mira_c23690___NYMVKDLGMALQGAEEMGVSLPGTALHHQLYLSMKANGDGWLGSHAFITAIERLSNHSLPSPG
A9NZ37__________________NHFVKDLGISLRECQQMGLSLPGLALAQQLYVSLKAHGEGNLGTQALVLALERLNNVQLPKIG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)