UniGene Name: biog3_v1.0_unigene23881
Length: 216 nt
UniGene Fasta
|
|---|
| >biog3_v1.0_unigene23881
A |
Ace file of the UniGene biog3_v1.0_unigene23881
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene696 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | FACT complex subunit n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TYN6_PHYPA | - | - | 0.0 | 69% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Blast2go | fact complex subunit | - | - | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | DNA replication | GO:0006260 | Biological Process | 0.0 | 83% |
| Blast2go | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | 83% |
| Blast2go | DNA repair | GO:0006281 | Biological Process | 0.0 | 83% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 83% |
| Blast2go | chromosome | GO:0005694 | Cellular Component | 0.0 | 83% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ABN5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 316 aas, W2: There is no M at the beginning, your sequence is shorter than subject: 57 - 372
Fln protein:
C
Protein Length:
58
Fln nts:
A
Fln Alignment:
biogeco3_mira_c23297___ESHYNGFRYSTMRAEERVDIMFQNIKHAFFQPAEKE
D5ABN5__________________ESHYNGFRYSTMRAEERVDVMYQNIKHAFFQPAEKE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta