UniGene Name: biog3_v1.0_unigene23869
Length: 138 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene23869
G |
Ace file of the UniGene biog3_v1.0_unigene23869 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4048 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Selaginella moellendorffii RepID=D8S7A6_SELML | - | - | 0.0 | 86% |
| FL-Next | sp=Ubiquitin carboxyl-terminal hydrolase 3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 71% |
| Blast2go | protein | - | - | 0.0 | 88% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Ubiquitin thiolesterase. | EC:3.1.2.15 | - | 0.0 | 88% |
| Blast2go | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 0.0 | 88% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | 88% |
| Blast2go | ubiquitin-specific protease activity | GO:0004843 | Molecular Function | 0.0 | 88% |
| Blast2go | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | 88% |
| Blast2go | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | 88% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 88% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 | IPR001394 | - | 0.0 | - |
| Sma3 | Lipase, class 3 | IPR002921 | - | 0.0 | - |
| Sma3 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site | IPR018200 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O24454
Fln msg: Distance to subject end: 273 aas, your sequence is shorter than subject: 46 - 371
Fln protein:
D
Protein Length:
47
Fln nts:
G
Fln Alignment:
biogeco3_mira_c23282___DYYSRTKTGRETEENLLTCLADLFTQIYSQKKKTGVIAPKRFVQRV
O24454__________________EYYTSNKSVADAEENLMTCLADLFSQISSQKKKTGVIAPKRFVQRL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)