|
||||||
|
UniGene Name: biog3_v1.0_unigene23770
Length: 177 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene23770
C |
|
Ace file of the UniGene biog3_v1.0_unigene23770 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene6793 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | PREDICTED: similar to FIO1 (FIONA1) n=1 Tax=Vitis vinifera RepID=UPI0001982DB3 | - | - | 0.0 | 56% |
| FL-Next | tr=Putative uncharacterized protein; Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). | - | - | 0.0 | 48% |
| Blast2go | ribosomal rna large subunit methyltransferase f | - | - | 0.0 | 69% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 69% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | circadian rhythm | GO:0007623 | Biological Process | 0.0 | 69% |
| Blast2go | photoperiodism, flowering | GO:0048573 | Biological Process | 0.0 | 69% |
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 69% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 69% |
| Blast2go | nucleus | GO:0005634 | Cellular Component | 0.0 | 69% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 69% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | S-adenosyl-L-methionine dependent methyltransferase, predicted | IPR010286 | - | 0.0 | - |
| Sma3 | S-adenosyl-L-methionine dependent methyltransferase, Mett10D, predicted | IPR017182 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7LKZ6
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 91 aas, your sequence is shorter than subject: 56 - 477
Fln protein:
P
Protein Length:
57
Fln nts:
C
Fln Alignment:
biogeco3_mira_c23127___SRTVGVPPMTENTNLSFMLEGLPRHCSASQLLNSVEHFFLACSASCRVDS
D7LKZ6__________________ARKIIAPPVVKKSVLSFMLEGIKRQYSAVDVLQSVEEFFKSCGASCKLNS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
