|
||||||
|
UniGene Name: biog3_v1.0_unigene23381
Length: 238 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene23381
G |
|
Ace file of the UniGene biog3_v1.0_unigene23381
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene5347 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | S-adenosylmethionine-dependent methyltransferase domain-containing protein [Arabidopsis thaliana] gb|AAK96498.1| At1g69520/F10D13_17 [Arabidopsis thaliana] gb|AAM19977.1| At1g69520/F10D13_17 [Arabidopsis thaliana] gb|AEE34938.1| S-adenosylmethionine-depen | - | - | 0.0 | 50% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
| Blast2go | s-adenosylmethionine-dependent methyltransferase domain-containing protein | - | - | 0.0 | 69% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 0.0 | 69% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | methylation | GO:0032259 | Biological Process | 0.0 | 69% |
| Blast2go | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | 69% |
| Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 69% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB68
Fln msg: Distance to subject end: 261 aas, your sequence is shorter than subject: 72 - 333
Fln protein:
M
Protein Length:
73
Fln nts:
G
Fln Alignment:
biogeco3_mira_c22552___MALPNSSRYSQGFPSHSNCLTHSLHTATLPFSIFKLQILHNKKQQPLKLR
D5AB68__________________MALSNSSLYSHSFPSHPNCLTPSPHTTTLPFPIFKVNILNKKKQQQLRLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
