|
||||||
|
UniGene Name: biog3_v1.0_unigene23264
Length: 247 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene23264
A |
|
Ace file of the UniGene biog3_v1.0_unigene23264
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene13204 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 1-deoxy-D-xylulose 5-phosphate synthase type II n=1 Tax=Picea abies RepID=A7LA02_PICAB | - | - | 0.0 | 91% |
| FL-Next | tr=1-deoxy-D-xylulose 5-phosphate synthase type II; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 91% |
| Blast2go | probable 1-deoxy-d-xylulose-5-phosphate chloroplastic-like | - | - | 0.0 | 89% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Oxidoreductases, Acting on the aldehyde or oxo group of donors, With a disulfide as acceptor. | EC:1.2.4.- | - | 0.0 | 89% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Lysine degradation | 00310 | 0.0 | 89% | |
| Blast2go | 1-deoxy-D-xylulose-5-phosphate synthase. | EC:2.2.1.7 | - | 0.0 | 89% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Terpenoid backbone biosynthesis | 00900 | 0.0 | 89% | |
| Blast2go | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | 89% | |
| Blast2go | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | 89% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 89% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 89% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 89% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | 89% |
| Blast2go | terpenoid biosynthetic process | GO:0016114 | Biological Process | 0.0 | 89% |
| Blast2go | oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor | GO:0016624 | Molecular Function | 0.0 | 89% |
| Blast2go | 1-deoxy-D-xylulose-5-phosphate synthase activity | GO:0008661 | Molecular Function | 0.0 | 89% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | BTB/POZ-like | IPR000210 | - | 0.0 | - |
| Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
| Sma3 | Like-Sm ribonucleoprotein (LSM) domain | IPR001163 | - | 0.0 | - |
| Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
| Sma3 | Transketolase, N-terminal | IPR005474 | - | 0.0 | - |
| Sma3 | Transketolase-like, pyrimidine-binding domain | IPR005475 | - | 0.0 | - |
| Sma3 | Transketolase, C-terminal | IPR005476 | - | 0.0 | - |
| Sma3 | Deoxyxylulose-5-phosphate synthase | IPR005477 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | BTB/POZ | IPR013069 | - | 0.0 | - |
| Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
| Sma3 | Transketolase-like, C-terminal | IPR015941 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A7LA02
Fln msg: Distance to subject end: 311 aas, your sequence is shorter than subject: 82 - 746
Fln protein:
N
Protein Length:
83
Fln nts:
A
Fln Alignment:
biogeco3_mira_c22368___IQDLVCILENVKSMPAPGPVLIHAVTEKGKGYPPAEKAADKLHGVVKFDPATGKQFKPKSSTLSHTQYFADSLIAEAERD
A7LA02__________________IQDLVAILENVKSMPTPGPVLIHVVTEKGKGYPPAEKAADKLHGVVKFDPATGKQFKPKSSTLSYTQYFAEGLMAEAERD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
