|
||||||
|
UniGene Name: biog3_v1.0_unigene22370
Length: 212 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene22370
A |
|
Ace file of the UniGene biog3_v1.0_unigene22370
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene1563 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Histidyl-tRNA synthetase n=3 Tax=Andropogoneae RepID=B6TS97_MAIZE | - | - | 0.0 | 65% |
| FL-Next | tr=Predicted protein; Micromonas sp. (strain RCC299 / NOUM17) (Picoplanktonic green alga). | - | - | 0.0 | 62% |
| Blast2go | protein | - | - | 0.0 | 81% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Histidine--tRNA ligase. | EC:6.1.1.21 | - | 0.0 | 81% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Aminoacyl-tRNA biosynthesis | 00970 | 0.0 | 81% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | primary root development | GO:0080022 | Biological Process | 0.0 | 81% |
| Blast2go | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | 81% |
| Blast2go | histidyl-tRNA aminoacylation | GO:0006427 | Biological Process | 0.0 | 81% |
| Blast2go | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | 81% |
| Blast2go | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | 81% |
| Blast2go | DNA binding | GO:0003677 | Molecular Function | 0.0 | 81% |
| Blast2go | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | 81% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 81% |
| Blast2go | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | 81% |
| Blast2go | histidine-tRNA ligase activity | GO:0004821 | Molecular Function | 0.0 | 81% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 81% |
| Blast2go | chloroplast | GO:0009507 | Cellular Component | 0.0 | 81% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminoacyl-tRNA synthetase, class II (G/ H/ P/ S), conserved domain | IPR002314 | - | 0.0 | - |
| Sma3 | Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase, EutT/PduO type | IPR002779 | - | 0.0 | - |
| Sma3 | Anticodon-binding | IPR004154 | - | 0.0 | - |
| Sma3 | Histidyl-tRNA synthetase, class IIa | IPR004516 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class II | IPR006195 | - | 0.0 | - |
| Sma3 | Histidyl-tRNA synthetase, class IIa, subgroup | IPR015807 | - | 0.0 | - |
| Sma3 | Adenosylcobalamin biosynthesis, ATP:cob(I)alamin adenosyltransferase, PduO-type, N-terminal | IPR017858 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: C1EFG4
Fln msg: Distance to subject end: 229 aas, your sequence is shorter than subject: 70 - 407
Fln protein:
C
Protein Length:
71
Fln nts:
A
Fln Alignment:
biogeco3_mira_c21034___DIFGVSGIEAEAELLSAIVTFFKQLGITSSDVGIKVSSRKVLEAVMEHHSIPKDSFSAVCVRLTRLSKM
C1EFG4__________________DIVGVEGVEAEAELLAAITDFFTRLGITSADVGIKVSSRKVLQAVLRRFDVPDDSFAPVCVVVDKIEKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
