UniGene Name: biog3_v1.0_unigene21588
Length: 242 nt
UniGene Fasta
|
|---|
| >biog3_v1.0_unigene21588
T |
Ace file of the UniGene biog3_v1.0_unigene21588
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene14365 | 1/2 |
| SustainPine v2.0 | sp_v2.0_unigene24470 | 1/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pollen major allergen No.121 isoform 1 n=1 Tax=Cryptomeria japonica RepID=Q588C0_CRYJA | - | - | 0.0 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Blast2go | xyloglucan endotransglucosylase hydrolase | - | - | 0.0 | 79% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Hydrolases, Glycosylases, Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds. | EC:3.2.1.- | - | 0.0 | 79% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Ascorbate and aldarate metabolism | 00053 | 0.0 | 79% | |
| Blast2go | Ubiquinone and other terpenoid-quinone biosynthesis | 00130 | 0.0 | 79% | |
| Blast2go | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | 79% | |
| Blast2go | Glycosaminoglycan degradation | 00531 | 0.0 | 79% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 79% | |
| Blast2go | Xyloglucan:xyloglucosyl transferase. | EC:2.4.1.207 | - | 0.0 | 79% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | cellular glucan metabolic process | GO:0006073 | Biological Process | 0.0 | 79% |
| Blast2go | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | 79% |
| Blast2go | xyloglucan:xyloglucosyl transferase activity | GO:0016762 | Molecular Function | 0.0 | 79% |
| Blast2go | apoplast | GO:0048046 | Cellular Component | 0.0 | 79% |
| Blast2go | cell wall | GO:0005618 | Cellular Component | 0.0 | 79% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 16 | IPR000757 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
| Sma3 | Beta-glucanase | IPR008264 | - | 0.0 | - |
| Sma3 | Xyloglucan endo-transglycosylase, C-terminal | IPR010713 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Xyloglucan endotransglucosylase/hydrolase | IPR016455 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, conserved site | IPR018483 | - | 0.0 | - |
| Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NLP1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 160 aas, your sequence is shorter than subject: 80 - 273
Fln protein:
L
Protein Length:
81
Fln nts:
T
Fln Alignment:
biogeco3_mira_c19902___TGCGIQSKQEYLFAKIDIQIKLVPGNSAGTVTTFYLSSQGPKHDEIDFEFLGNLSGDPY
A9NLP1__________________SGCGIQSKQEYLFAKIDMQIKLIPGNSAGTVTTYYLSSQGPKHDEIDFEFLGNLSGDPY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta