|
||||||
|
UniGene Name: biog3_v1.0_unigene21183
Length: 239 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene21183
A |
|
Ace file of the UniGene biog3_v1.0_unigene21183
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene325 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica Group] dbj|BAD30579.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica Group] | - | - | 0.0 | 56% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Blast2go | protein | - | - | 0.0 | 74% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Oxidoreductases, Acting on the CH-OH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.1.1.- | - | 0.0 | 74% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 74% |
| Blast2go | NAD binding | GO:0051287 | Molecular Function | 0.0 | 74% |
| Blast2go | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | 74% |
| Blast2go | mitochondrion | GO:0005739 | Cellular Component | 0.0 | 74% |
| Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 74% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain | IPR006139 | - | 0.0 | - |
| Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRC1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 201 aas, your sequence is shorter than subject: 79 - 355
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
biogeco3_mira_c19303___GVDIEAATKFGIKVARIPGNTSGNSLSCAEHAIYLILGLLRDQKGMEKAFKERLLGVPTGETLY
B8LRC1__________________GVDIEAATKFGIKVARIPGNTSGNSLSCAEHAIYLILGLLRDQKGMEKAFKERMLGVPAGETLY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
