|
||||||
|
UniGene Name: biog3_v1.0_unigene21110
Length: 204 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene21110
A |
|
Ace file of the UniGene biog3_v1.0_unigene21110 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3004 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Protein kinase APK1B, chloroplast, putative n=1 Tax=Ricinus communis RepID=B9SPN3_RICCO | - | - | 0.0 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Blast2go | protein | - | - | 0.0 | 75% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 75% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | apoptotic process | GO:0006915 | Biological Process | 0.0 | 75% |
| Blast2go | defense response | GO:0006952 | Biological Process | 0.0 | 75% |
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 75% |
| Blast2go | DNA repair | GO:0006281 | Biological Process | 0.0 | 75% |
| Blast2go | nuclease activity | GO:0004518 | Molecular Function | 0.0 | 75% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 75% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 75% |
| Blast2go | intracellular | GO:0005622 | Cellular Component | 0.0 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRZ4
Fln msg: Distance to subject end: 237 aas, your sequence is shorter than subject: 68 - 511
Fln protein:
N
Protein Length:
69
Fln nts:
A
Fln Alignment:
biogeco3_mira_c19195___GTLVLKNDVFSFGILLLEIISGRNAIDVQYSPPSIVDWAMPLIRQNKILELYDPRLSP
B8LRZ4__________________GNLSTKNDVFSFGILLLEIISGRNAIDVQYSPPSIVDWAMPLIRQNKILELYDPRLSP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
