|
||||||
|
UniGene Name: biog3_v1.0_unigene19892
Length: 216 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene19892
C |
|
Ace file of the UniGene biog3_v1.0_unigene19892 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4807 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative receptor protein kinase [Arabidopsis thaliana] gb|ACN59306.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gb|AEC09344.1| putative receptor protein kinase [Arabidopsis thaliana] | - | - | 0.0 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 46% |
| Blast2go | probable lrr receptor-like serine threonine-protein kinase at1g67720-like | - | - | 0.0 | 78% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 78% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 78% |
| Blast2go | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | 78% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 78% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 78% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 78% |
| Blast2go | plasma membrane | GO:0005886 | Cellular Component | 0.0 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKY1
Fln msg: Overlapping hits, possible frame ERROR between 78 and 75, Distance to subject end: 111 aas, your sequence is shorter than subject: 72 - 431
Fln protein:
H
Protein Length:
73
Fln nts:
C
Fln Alignment:
biogeco3_mira_c17406___HVSSLVRGTVGYLDPEYYVSQQFTExSDVYSFGVVLLEMISGREAISDEGFGVNFRNIVQWAR-YNIDKGDIH
B8LKY1__________________HVSTRVMGTYGYAAPEYVMTGHLTSxSDVYSFGVVLLEMLTGRRSI-DKHRSNGEQNLVEWARPYLVDKRKLY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
