|
||||||
|
UniGene Name: biog3_v1.0_unigene19654
Length: 202 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene19654
A |
|
Ace file of the UniGene biog3_v1.0_unigene19654
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene3299 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | mitochondrial carrier-like protein [Solanum tuberosum] | - | - | 0.0 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Blast2go | grave disease carrier | - | - | 0.0 | 88% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | aerobic respiration | GO:0009060 | Biological Process | 0.0 | 88% |
| Blast2go | AMP transport | GO:0080121 | Biological Process | 0.0 | 88% |
| Blast2go | ADP transport | GO:0015866 | Biological Process | 0.0 | 88% |
| Blast2go | mitochondrial transport | GO:0006839 | Biological Process | 0.0 | 88% |
| Blast2go | ATP transport | GO:0015867 | Biological Process | 0.0 | 88% |
| Blast2go | AMP transmembrane transporter activity | GO:0080122 | Molecular Function | 0.0 | 88% |
| Blast2go | binding | GO:0005488 | Molecular Function | 0.0 | 88% |
| Blast2go | ATP transmembrane transporter activity | GO:0005347 | Molecular Function | 0.0 | 88% |
| Blast2go | ADP transmembrane transporter activity | GO:0015217 | Molecular Function | 0.0 | 88% |
| Blast2go | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | 88% |
| Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | 88% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 88% |
| Blast2go | plastid | GO:0009536 | Cellular Component | 0.0 | 88% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR001993 | - | 0.0 | - | |
| Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
| Sma3 | Mitochondrial carrier protein | IPR002067 | - | 0.0 | - |
| Sma3 | Adenine nucleotide translocator 1 | IPR002113 | - | 0.0 | - |
| Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
| Sma3 | Graves disease carrier protein | IPR002167 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | Mitochondrial substrate/solute carrier | IPR018108 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
| Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADX1
Fln msg: Distance to subject end: 53 aas, your sequence is shorter than subject: 67 - 371
Fln protein:
L
Protein Length:
68
Fln nts:
A
Fln Alignment:
biogeco3_mira_c17065___GLAEDSELNVVTKLXXXXXXXXXXXXXXYPLDVVRRRMQMSGWKDAASCFVTGDGRNKAPVHYS
D5ADX1__________________GLVEGEDLSMVTKLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDASS-IVTGDGRSKAPLQYS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
