|
||||||
|
UniGene Name: biog3_v1.0_unigene19542
Length: 158 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene19542
A |
|
Ace file of the UniGene biog3_v1.0_unigene19542 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene10600 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative cadmium/zinc-transporting ATPase HMA1 [Arabidopsis thaliana] sp|Q9M3H5.2|AHM1_ARATH RecName: Full=Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic; Flags: Precursor emb|CAB16773.1| Cu2+-transporting ATPase-like protein [Arabidopsis t | - | - | 0.0 | 60% |
| FL-Next | sp=Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 56% |
| Blast2go | cadmium resistance protein | - | - | 0.0 | 80% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Copper-exporting ATPase. | EC:3.6.3.4 | - | 0.0 | 80% |
| Blast2go | Cadmium-transporting ATPase. | EC:3.6.3.46 | - | 0.0 | 80% |
| Blast2go | Calcium-transporting ATPase. | EC:3.6.3.8 | - | 0.0 | 80% |
| Blast2go | Zinc-exporting ATPase. | EC:3.6.3.5 | - | 0.0 | 80% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | zinc ion homeostasis | GO:0055069 | Biological Process | 0.0 | 80% |
| Blast2go | response to light intensity | GO:0009642 | Biological Process | 0.0 | 80% |
| Blast2go | calcium ion transport | GO:0006816 | Biological Process | 0.0 | 80% |
| Blast2go | cellular copper ion homeostasis | GO:0006878 | Biological Process | 0.0 | 80% |
| Blast2go | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | 80% |
| Blast2go | response to toxin | GO:0009636 | Biological Process | 0.0 | 80% |
| Blast2go | ATP catabolic process | GO:0006200 | Biological Process | 0.0 | 80% |
| Blast2go | zinc transporting ATPase activity | GO:0015633 | Molecular Function | 0.0 | 80% |
| Blast2go | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | 80% |
| Blast2go | cadmium-transporting ATPase activity | GO:0015434 | Molecular Function | 0.0 | 80% |
| Blast2go | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | 80% |
| Blast2go | zinc-exporting ATPase activity | GO:0016463 | Molecular Function | 0.0 | 80% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 80% |
| Blast2go | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | 80% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 80% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating | IPR006404 | - | 0.0 | - |
| Sma3 | ATPase, P-type, heavy metal translocating | IPR006416 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9M3H5
Fln msg: Distance to subject end: 198 aas, your sequence is shorter than subject: 52 - 819
Fln protein:
N
Protein Length:
53
Fln nts:
A
Fln Alignment:
biogeco3_mira_c16917___NEFESRKIKEAASASPYGQDLVHAVLSVNNKVTLFHFEDKIRPGATDVVS
Q9M3H5__________________SEDESKQIKDAVNASSYGKDFVHAALSVDQKVTLIHLEDQPRPGVSGVIA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
