UniGene Name: biog3_v1.0_unigene19389
Length: 190 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene19389
G |
Ace file of the UniGene biog3_v1.0_unigene19389 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4919 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | CTR1-like protein kinase [Solanum lycopersicum] gb|AAR89823.1| CTR1-like protein kinase [Solanum lycopersicum] | - | - | 0.0 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Blast2go | ctr1-like protein kinase | - | - | 0.0 | 84% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 0.0 | 84% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 84% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 84% |
| Blast2go | MAP kinase kinase kinase activity | GO:0004709 | Molecular Function | 0.0 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5A8V0
Fln msg: your sequence is shorter than subject: 58 - 319
Fln protein:
R
Protein Length:
59
Fln nts:
G
Fln Alignment:
biogeco3_mira_c16715___RLQIPKDVKPEIAAIIEACWANDPRKRPSFASIMDLLKPLVKPPTSQQIRGVTLPPA
D5A8V0__________________RLQIPKDVKPDIAAIIEACWANDSRKRPSFASIMELLKPLVKPPTPQPIRGVTLPPA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)