|
||||||
|
UniGene Name: biog3_v1.0_unigene19319
Length: 233 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene19319
A |
|
Ace file of the UniGene biog3_v1.0_unigene19319
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene2251 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | acyl-CoA oxidase [Arabidopsis thaliana] | - | - | 0.0 | 73% |
| FL-Next | sp=Acyl-coenzyme A oxidase 2, peroxisomal; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 74% |
| Blast2go | acyl- oxidase | - | - | 0.0 | 84% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Acyl-CoA dehydrogenase. | EC:1.3.99.3 | - | 0.0 | 84% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 84% | |
| Blast2go | Valine, leucine and isoleucine degradation | 00280 | 0.0 | 84% | |
| Blast2go | beta-Alanine metabolism | 00410 | 0.0 | 84% | |
| Blast2go | Propanoate metabolism | 00640 | 0.0 | 84% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 84% | |
| Blast2go | Biosynthesis of secondary metabolites | 01110 | 0.0 | 84% | |
| Blast2go | Acyl-CoA oxidase. | EC:1.3.3.6 | - | 0.0 | 84% |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Fatty acid metabolism | 00071 | 0.0 | 84% | |
| Blast2go | alpha-Linolenic acid metabolism | 00592 | 0.0 | 84% | |
| Blast2go | Biosynthesis of unsaturated fatty acids | 01040 | 0.0 | 84% | |
| Blast2go | Biosynthesis of plant hormones | 01070 | 0.0 | 84% | |
| Blast2go | Metabolic pathways | 01100 | 0.0 | 84% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | long-chain fatty acid metabolic process | GO:0001676 | Biological Process | 0.0 | 84% |
| Blast2go | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | 84% |
| Blast2go | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | 84% |
| Blast2go | acyl-CoA dehydrogenase activity | GO:0003995 | Molecular Function | 0.0 | 84% |
| Blast2go | acyl-CoA oxidase activity | GO:0003997 | Molecular Function | 0.0 | 84% |
| Blast2go | glyoxysome | GO:0009514 | Cellular Component | 0.0 | 84% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase, C-terminal | IPR002655 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase/dehydrogenase, type 1 | IPR006090 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase/dehydrogenase, central domain | IPR006091 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase | IPR012258 | - | 0.0 | - |
| Sma3 | IPR013764 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O65201
Fln msg: Distance to subject end: 118 aas, your sequence is shorter than subject: 77 - 692
Fln protein:
N
Protein Length:
78
Fln nts:
A
Fln Alignment:
biogeco3_mira_c16621___GGTFNVTWNYLRDMMTTYLSEANPVIARREGQDHLRDPKFQLDAFRYRTSRLLHTAALRLRKHSKSLGSFEAWNR
O65201__________________GGTLTVTWSYLRESMNTYLSQPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
