|
||||||
|
UniGene Name: biog3_v1.0_unigene19025
Length: 154 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene19025
A |
|
Ace file of the UniGene biog3_v1.0_unigene19025 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene5835 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DsRNA-specific nuclease dicer and related ribonuclease n=2 Tax=Physcomitrella patens RepID=A9RV91_PHYPA | - | - | 0.0 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Blast2go | endoribonuclease dicer | - | - | 0.0 | 83% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Ribonuclease III. | EC:3.1.26.3 | - | 0.0 | 83% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | flower development | GO:0009908 | Biological Process | 0.0 | 83% |
| Blast2go | embryonic pattern specification | GO:0009880 | Biological Process | 0.0 | 83% |
| Blast2go | suspensor development | GO:0010098 | Biological Process | 0.0 | 83% |
| Blast2go | primary miRNA processing | GO:0031053 | Biological Process | 0.0 | 83% |
| Blast2go | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | 83% |
| Blast2go | mRNA cleavage involved in gene silencing by miRNA | GO:0035279 | Biological Process | 0.0 | 83% |
| Blast2go | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | 83% |
| Blast2go | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | 83% |
| Blast2go | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | 83% |
| Blast2go | cytokinesis | GO:0000910 | Biological Process | 0.0 | 83% |
| Blast2go | ribonuclease III activity | GO:0004525 | Molecular Function | 0.0 | 83% |
| Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 83% |
| Blast2go | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | 83% |
| Blast2go | DNA binding | GO:0003677 | Molecular Function | 0.0 | 83% |
| Blast2go | double-stranded RNA binding | GO:0003725 | Molecular Function | 0.0 | 83% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 83% |
| Blast2go | nuclear dicing body | GO:0010445 | Cellular Component | 0.0 | 83% |
| Blast2go | regulation of seed maturation | GO:2000034 | Biological Process | 0.0 | 83% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribonuclease III domain | IPR000999 | - | 0.0 | - |
| Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
| Sma3 | Dicer double-stranded RNA-binding fold | IPR005034 | - | 0.0 | - |
| Sma3 | Helicase/UvrB domain | IPR006935 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
| Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW09
Fln msg: Distance to subject end: 164 aas, your sequence is shorter than subject: 51 - 330
Fln protein:
M
Protein Length:
52
Fln nts:
A
Fln Alignment:
biogeco3_mira_c16221___YQRLEFVGDAVLDHLITRHLFFTYTDLPPGRLTDLRAAAVNNENFARVAV
A9NW09__________________YQRLEFLGDAVLDYLITLYFYKTYPGLSPGLLTDLRSAAVNNDCYAQAAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
