|
||||||
|
UniGene Name: biog3_v1.0_unigene18309
Length: 234 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene18309
A |
|
Ace file of the UniGene biog3_v1.0_unigene18309
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene937 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Hydroquinone glucosyltransferase n=1 Tax=Rauvolfia serpentina RepID=HQGT_RAUSE | - | - | 0.0 | 39% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Blast2go | hydroquinone glucosyltransferase-like | - | - | 0.0 | 55% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 0.0 | 55% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 55% |
| Blast2go | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | 55% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR79
Fln msg: Overlapping hits, possible frame ERROR between 64 and 60, Distance to subject end: 193 aas, your sequence is shorter than subject: 78 - 482
Fln protein:
M
Protein Length:
79
Fln nts:
A
Fln Alignment:
biogeco3_mira_c15235___MFFTRMADGVLVNTFFEMExxFLGHLKSVGVGGDGSKPVWAVGPVIDLPRRD-KIRARRDAEILEWLDRQSPGSVVYL
B8LR79__________________MEYTRLADGVLLNTFLELExxFIRHLQS----GGGGKLFWAVGPVIDLPDRDHKLHSPREGEILEWLGRQTRGSVVYV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
