|
||||||
|
UniGene Name: biog3_v1.0_unigene17621
Length: 210 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >biog3_v1.0_unigene17621
T |
|
Ace file of the UniGene biog3_v1.0_unigene17621 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene6653 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | leucine-rich repeat receptor-like kinase [Ipomoea batatas] | - | - | 0.0 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
| Blast2go | brassinosteroid insensitive 1-associated receptor kinase 1 | - | - | 0.0 | 81% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 0.0 | 81% |
| Blast2go | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 0.0 | 81% |
| Blast2go | 2-alkenal reductase. | EC:1.3.1.74 | - | 0.0 | 81% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | 81% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 81% |
| Blast2go | receptor activity | GO:0004872 | Molecular Function | 0.0 | 81% |
| Blast2go | non-membrane spanning protein tyrosine kinase activity | GO:0004715 | Molecular Function | 0.0 | 81% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 81% |
| Blast2go | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | 81% |
| Blast2go | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | 81% |
| Blast2go | cytoplasmic membrane-bounded vesicle | GO:0016023 | Cellular Component | 0.0 | 81% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 81% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Calponin homology domain | IPR001715 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
| Sma3 | Adenovirus E3 region protein CR2 | IPR003470 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat, typical subtype | IPR003591 | - | 0.0 | - |
| Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZ80
Fln msg: Distance to subject end: 48 aas, your sequence is shorter than subject: 70 - 172
Fln protein:
F
Protein Length:
71
Fln nts:
T
Fln Alignment:
biogeco3_mira_c14280___VMLDWVKKVYQEXXXXXXXXXXXKGFFDRVELEEMVQVALLCTQFHPAHRPKMSEVVRM
A9NZ80__________________MLLDWVKGMLRERRLDRLVDPELQSNYEETEVEELIQVALLCTQNSPMERPKMADVVRM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
