UniGene Name: biog3_v1.0_unigene16281
Length: 217 nt
UniGene Fasta
|
|---|
| >biog3_v1.0_unigene16281
G |
Ace file of the UniGene biog3_v1.0_unigene16281
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene4994 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MRP-like ABC transporter [Oryza sativa Japonica Group] | - | - | 0.0 | 72% |
| FL-Next | sp=ABC transporter C family member 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 76% |
| Blast2go | multidrug resistance protein abc transporter family | - | - | 0.0 | 88% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 0.0 | 88% |
| Blast2go | 2-alkenal reductase. | EC:1.3.1.74 | - | 0.0 | 88% |
| Blast2go | Arsenite-transporting ATPase. | EC:3.6.3.16 | - | 0.0 | 88% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | arsenite transport | GO:0015700 | Biological Process | 0.0 | 88% |
| Blast2go | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | 88% |
| Blast2go | ATP catabolic process | GO:0006200 | Biological Process | 0.0 | 88% |
| Blast2go | response to arsenic-containing substance | GO:0046685 | Biological Process | 0.0 | 88% |
| Blast2go | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | 88% |
| Blast2go | 2-alkenal reductase [NAD(P)] activity | GO:0032440 | Molecular Function | 0.0 | 88% |
| Blast2go | ATP binding | GO:0005524 | Molecular Function | 0.0 | 88% |
| Blast2go | protein binding | GO:0005515 | Molecular Function | 0.0 | 88% |
| Blast2go | arsenite-transmembrane transporting ATPase activity | GO:0015446 | Molecular Function | 0.0 | 88% |
| Blast2go | integral to membrane | GO:0016021 | Cellular Component | 0.0 | 88% |
| Blast2go | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | 88% |
| Blast2go | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | 88% |
| Blast2go | phytochelatin transmembrane transporter activity | GO:0071992 | Biological Process | 0.0 | 88% |
| Blast2go | phytochelatin transmembrane transport | GO:0071994 | Biological Process | 0.0 | 88% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter, transmembrane domain | IPR001140 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I3, Kunitz legume | IPR002160 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C8G9
Fln msg: Distance to subject end: 953 aas, your sequence is shorter than subject: 72 - 1622
Fln protein:
E
Protein Length:
73
Fln nts:
G
Fln Alignment:
biogeco3_mira_c12340___ERILQPNPPIQAGLPAISIKNGTFSWDKKAENATLSNIHLDISVGSLVAVVGSTGEGKTSLISAILGEI
Q9C8G9__________________ERVLLPNPPIEPGQPAISIRNGYFSWDSKADRPTLSNINLDIPLGSLVAVVGSTGEGKTSLISAMLGEL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta