|
||||||
|
UniGene Name: biog3_v1.0_unigene16145
Length: 214 nt
 UniGene Fasta
|
|---|
| >biog3_v1.0_unigene16145
A |
|
Ace file of the UniGene biog3_v1.0_unigene16145
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Parent Assembly | Parent UniGene | Reads (related/total) |
|---|---|---|
| SustainPine v2.0 | sp_v2.0_unigene810 | 2/2 |
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-glucosyltransferase, putative n=1 Tax=Ricinus communis RepID=B9T117_RICCO | - | - | 0.0 | 38% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Blast2go | udp-glycosyltransferase 73c3 | - | - | 0.0 | 66% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 0.0 | 66% |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Blast2go | metabolic process | GO:0008152 | Biological Process | 0.0 | 66% |
| Blast2go | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | 66% |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWC5
Fln msg: Distance to subject end: 461 aas, your sequence is shorter than subject: 49 - 510
Fln protein:
M
Protein Length:
50
Fln nts:
A
Fln Alignment:
biogeco3_mira_c12142___MKGSEKPHVVLVPFPALGHSIPFFDLARLLSLHGAAVSYVTTPAGACRV
A9NWC5__________________MKGSQKPHVVLLPFPAMGHSIPFLDLARLLALNGAAVSCVTTGANASRL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
